RegulonDB RegulonDB 10.8: Gene Form
   

fadR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nhaB ycgB fadR FadR DksA-ppGpp DksA-ppGpp TSS_1516 TSS_1516 TSS_1515 TSS_1515 TSS_1514 TSS_1514 TSS_1513 TSS_1513 fadRp2 fadRp2 fadRp fadRp nhaBp7 nhaBp7

Gene      
Name: fadR    Texpresso search in the literature
Synonym(s): ECK1175, EG10281, b1187, dec, ole, oleR, thdB
Genome position(nucleotides): 1234938 --> 1235657 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.25
External database links:  
ASAP:
ABE-0003988
CGSC:
789
ECHOBASE:
EB0277
OU-MICROARRAY:
b1187
PortEco:
fadR
STRING:
511145.b1187
COLOMBOS: fadR


Product      
Name: DNA-binding transcriptional dual regulator FadR
Synonym(s): Dec, FadR, Ole, OleR, ThdB
Sequence: Get amino acid sequence Fasta Format
Regulator Family: GntR
Cellular location: cytosol
Molecular weight: 26.969
Isoelectric point: 7.029
Motif(s):
 
Type Positions Sequence
9 -> 9 A
66 -> 66 G
72 -> 234 NNFWETSGLNILETLARLDHESVPQLIDNLLSVRTNISTIFIRTAFRQHPDKAQEVLATANEVADHADAFAELDYNIFRGLAFASGNPIYGLILNGMKGLYTRIGRHYFANPEARSLALGFYHKLSALCSEGAHDQVYETVRRYGHESGEIWHRMQKNLPGDL
11 -> 71 FAEEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKPTKV
6 -> 74 QSPAGFAEEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKPTKVNNF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.2 - fatty acids
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.2 - regulon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000062 - fatty-acyl-CoA binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0006629 - lipid metabolic process
GO:0006631 - fatty acid metabolic process
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0019217 - regulation of fatty acid metabolic process
GO:0045723 - positive regulation of fatty acid biosynthetic process
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[HIFS] Human inference of function from sequence
[IEP] Inferred from expression pattern
Reference(s): [1] Campbell JW., et al., 2001
[2] Cronan JE., et al., 1998
[3] DiRusso CC. 1988
[4] DiRusso CC., et al., 1992
[5] DiRusso CC., et al., 1993
External database links:  
DIP:
DIP-9564N
ECOCYC:
PD01520
ECOLIWIKI:
b1187
INTERPRO:
IPR000524
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR028374
INTERPRO:
IPR014178
INTERPRO:
IPR008920
MINT:
MINT-1264978
MODBASE:
P0A8V6
PANTHER:
PTHR43537:SF10
PDB:
1HW1
PDB:
1HW2
PDB:
1E2X
PDB:
1H9G
PDB:
1H9T
PFAM:
PF07840
PFAM:
PF00392
PRIDE:
P0A8V6
PRINTS:
PR00035
PRODB:
PRO_000022573
PROSITE:
PS50949
REFSEQ:
NP_415705
SMART:
SM00345
SMR:
P0A8V6
UNIPROT:
P0A8V6


Operon      
Name: fadR         
Operon arrangement:
Transcription unit        Promoter
fadR
fadR


Transcriptional Regulation      
Display Regulation             
Activated by: FadR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter nhaBp7 1234767 reverse Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [6], [7]
  promoter TSS_1513 1236798 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_1514 1236840 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_1515 1237036 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_1516 1237229 reverse nd [RS-EPT-CBR] [7]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Campbell JW., Cronan JE., 2001, Escherichia coli FadR positively regulates transcription of the fabB fatty acid biosynthetic gene., J Bacteriol 183(20):5982-90

 [2] Cronan JE., Subrahmanyam S., 1998, FadR, transcriptional co-ordination of metabolic expediency., Mol Microbiol 29(4):937-43

 [3] DiRusso CC., 1988, Nucleotide sequence of the fadR gene, a multifunctional regulator of fatty acid metabolism in Escherichia coli., Nucleic Acids Res 16(16):7995-8009

 [4] DiRusso CC., Heimert TL., Metzger AK., 1992, Characterization of FadR, a global transcriptional regulator of fatty acid metabolism in Escherichia coli. Interaction with the fadB promoter is prevented by long chain fatty acyl coenzyme A., J Biol Chem 267(12):8685-91

 [5] DiRusso CC., Metzger AK., Heimert TL., 1993, Regulation of transcription of genes required for fatty acid transport and unsaturated fatty acid biosynthesis in Escherichia coli by FadR., Mol Microbiol 7(2):311-22

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB