RegulonDB RegulonDB 10.8: Gene Form
   

fdhF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fdhF mdtP yjcO mdtO FhlA FhlA Cis-reg terminator terminator fdhFp fdhFp TSS_4903 TSS_4903 yjcOp3 yjcOp3 yjcOp5 yjcOp5 yjcOp2 yjcOp2 yjcOp4 yjcOp4

Gene      
Name: fdhF    Texpresso search in the literature
Synonym(s): ECK4072, EG10285, b4079, chlF
Genome position(nucleotides): 4297219 <-- 4299366 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.38
External database links:  
ASAP:
ABE-0013363
CGSC:
18400
ECHOBASE:
EB0281
OU-MICROARRAY:
b4079
PortEco:
fdhF
STRING:
511145.b4079
COLOMBOS: fdhF


Product      
Name: formate dehydrogenase H
Synonym(s): ChlF, FDH-H, FdhF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space,cytosol
Molecular weight: 79.374
Isoelectric point: 6.249
Motif(s):
 
Type Positions Sequence
110 -> 112 RGT
173 -> 180 FGYNPADS
221 -> 223 GSN
1 -> 56 MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDTQ
428 -> 429 QD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0030288 - outer membrane-bounded periplasmic space
GO:0009326 - formate dehydrogenase complex
GO:0045272 - plasma membrane respiratory chain complex I
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0016903 - oxidoreductase activity, acting on the aldehyde or oxo group of donors
GO:0008863 - formate dehydrogenase (NAD+) activity
GO:0043546 - molybdopterin cofactor binding
biological_process GO:0019628 - urate catabolic process
GO:0045333 - cellular respiration
GO:0015942 - formate metabolic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Thome R., et al., 2012
External database links:  
DIP:
DIP-9572N
ECOCYC:
FORMATEDEHYDROGH-MONOMER
ECOLIWIKI:
b4079
INTERPRO:
IPR006963
INTERPRO:
IPR041925
INTERPRO:
IPR041924
INTERPRO:
IPR027467
INTERPRO:
IPR009010
INTERPRO:
IPR006657
INTERPRO:
IPR006656
INTERPRO:
IPR006655
INTERPRO:
IPR006478
PDB:
1AA6
PDB:
1FDI
PDB:
1FDO
PDB:
2IV2
PFAM:
PF04879
PFAM:
PF00384
PFAM:
PF01568
PRIDE:
P07658
PRODB:
PRO_000022580
PROSITE:
PS00551
PROSITE:
PS00490
PROSITE:
PS51669
PROSITE:
PS00932
REFSEQ:
NP_418503
SMART:
SM00926
SMR:
P07658
UNIPROT:
P07658


Operon      
Name: fdhF         
Operon arrangement:
Transcription unit        Promoter
fdhF


Transcriptional Regulation      
Display Regulation             
Activated by: FhlA, FNR, NarP
Repressed by: NarL


RNA cis-regulatory element    
Attenuation: Translational
   
Cis-reg Selenocysteine insertion sequence 2
   
   


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjcOp4 4297134 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yjcOp2 4297151 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yjcOp5 4297222 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yjcOp3 4297330 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_4903 4299298 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Thome R., Gust A., Toci R., Mendel R., Bittner F., Magalon A., Walburger A., 2012, A sulfurtransferase is essential for activity of formate dehydrogenases in Escherichia coli., J Biol Chem 287(7):4671-8

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB