RegulonDB RegulonDB 10.9: Gene Form
   

fecA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fecA fecR fecB fecC fecI Fur Fur Fur PdhR fecAp fecAp

Gene      
Name: fecA    Texpresso search in the literature
Synonym(s): ECK4281, EG10286, b4291
Genome position(nucleotides): 4514353 <-- 4516677 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.54
External database links:  
ASAP:
ABE-0014067
CGSC:
783
ECHOBASE:
EB0282
ECOLIHUB:
fecA
ECOO157CYC:
Z1178
ECOO157CYC:
Z4386
ECOO157CYC:
Z1617
OU-MICROARRAY:
b4291
STRING:
511145.b4291
COLOMBOS: fecA


Shine dalgarno      
Sequence: aaatgatgatGGGGAAggTAT


Product      
Name: ferric citrate outer membrane transporter
Synonym(s): FecA
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 85.321
Isoelectric point: 5.753
Motif(s):
 
Type Positions Sequence
300 -> 300 T
757 -> 774 GIYAGQPRTLYMQGSLKF
16 -> 16 T
190 -> 190 A
1 -> 33 MTPLRVFRKTTPLVNTIRLSLLPLAGLSFSAFA

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.1 - Channel-type Transporters --> 4.1.B - Beta barrel porins (The Outer Membrane Porin (OMP) Functional Superfamily)
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0019867 - outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
GO:0045203 - integral component of cell outer membrane
molecular_function GO:0005515 - protein binding
GO:0015091 - ferric iron transmembrane transporter activity
GO:0038023 - signaling receptor activity
GO:0015344 - siderophore uptake transmembrane transporter activity
biological_process GO:1990641 - response to iron ion starvation
GO:0023019 - signal transduction involved in regulation of gene expression
GO:0006355 - regulation of transcription, DNA-templated
GO:0006811 - ion transport
GO:0006826 - iron ion transport
GO:0055072 - iron ion homeostasis
GO:0015891 - siderophore transport
GO:0034755 - iron ion transmembrane transport
GO:0033214 - siderophore-dependent iron import into cell
GO:0044718 - siderophore transmembrane transport
GO:0072512 - trivalent inorganic cation transport
Note(s): Note(s): ...[more].
Reference(s): [1] Chakraborty R., et al., 2007
[2] Goswami M., et al., 2018
[3] Howard SP., et al., 2001
[4] Kim M., et al., 2007
[5] Lupino KM., et al., 2018
[6] Peacock RS., et al., 2006
[7] Piggot TJ., et al., 2013
[8] Pressler U., et al., 1988
[9] Sauter A., et al., 2004
[10] Welz D., et al., 1998
[11] Zhou XH., et al., 1993
[12] Zhou XH., et al., 1995
External database links:  
DIP:
DIP-9583N
ECOCYC:
EG10286-MONOMER
ECOLIWIKI:
b4291
ECOO157CYC:
Z1617-MONOMER
ECOO157CYC:
Z4386-MONOMER
ECOO157CYC:
Z1178-MONOMER
INTERPRO:
IPR037066
INTERPRO:
IPR000531
INTERPRO:
IPR010105
INTERPRO:
IPR010916
INTERPRO:
IPR010917
INTERPRO:
IPR011662
INTERPRO:
IPR012910
INTERPRO:
IPR036942
MODBASE:
P13036
PDB:
2D1U
PDB:
1ZZV
PDB:
1PO3
PDB:
1PO0
PDB:
1KMO
PDB:
1KMP
PDB:
1PNZ
PFAM:
PF07660
PFAM:
PF07715
PFAM:
PF00593
PRIDE:
P13036
PRODB:
PRO_000022591
PROSITE:
PS01156
PROSITE:
PS00430
REFSEQ:
NP_418711
SMART:
SM00965
SMR:
P13036
UNIPROT:
P13036


Operon      
Name: fecABCDE         
Operon arrangement:
Transcription unit        Promoter
fecABCDE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, PdhR
Repressed by: Fur, HypT
Undetermined regulation AscG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Chakraborty R., Storey E., van der Helm D., 2007, Molecular mechanism of ferricsiderophore passage through the outer membrane receptor proteins of Escherichia coli., Biometals 20(3-4):263-74

 [2] Goswami M., Narayana Rao AVSS., 2018, Transcriptome Profiling Reveals Interplay of Multifaceted Stress Response in Escherichia coli on Exposure to Glutathione and Ciprofloxacin., mSystems 3(1)

 [3] Howard SP., Herrmann C., Stratilo CW., Braun V., 2001, In vivo synthesis of the periplasmic domain of TonB inhibits transport through the FecA and FhuA iron siderophore transporters of Escherichia coli., J Bacteriol 183(20):5885-95

 [4] Kim M., Fanucci GE., Cafiso DS., 2007, Substrate-dependent transmembrane signaling in TonB-dependent transporters is not conserved., Proc Natl Acad Sci U S A 104(29):11975-80

 [5] Lupino KM., Romano KA., Simons MJ., Gregg JT., Panepinto L., Cruz GM., Grajek L., Caputo GA., Hickman MJ., Hecht GB., 2018, A Recurrent Silent Mutation Implicates fecA in Ethanol Tolerance by Escherichia coli., BMC Microbiol 18(1):36

 [6] Peacock RS., Andrushchenko VV., Demcoe AR., Gehmlich M., Lu LS., Herrero AG., Vogel HJ., 2006, Characterization of TonB interactions with the FepA cork domain and FecA N-terminal signaling domain., Biometals 19(2):127-42

 [7] Piggot TJ., Holdbrook DA., Khalid S., 2013, Conformational dynamics and membrane interactions of the E. coli outer membrane protein FecA: a molecular dynamics simulation study., Biochim Biophys Acta 1828(2):284-93

 [8] Pressler U., Staudenmaier H., Zimmermann L., Braun V., 1988, Genetics of the iron dicitrate transport system of Escherichia coli., J Bacteriol 170(6):2716-24

 [9] Sauter A., Braun V., 2004, Defined inactive FecA derivatives mutated in functional domains of the outer membrane transport and signaling protein of Escherichia coli K-12., J Bacteriol 186(16):5303-10

 [10] Welz D., Braun V., 1998, Ferric citrate transport of Escherichia coli: functional regions of the FecR transmembrane regulatory protein., J Bacteriol 180(9):2387-94

 [11] Zhou XH., van der Helm D., Adjimani J., 1993, Purification of outer membrane iron transport receptors from Escherichia coli by fast protein liquid chromatography: FepA and FecA., Biometals 6(1):25-35

 [12] Zhou XH., van der Helm D., Venkatramani L., 1995, Binding characterization of the iron transport receptor from the outer membrane of Escherichia coli (FepA): differentiation between FepA and FecA., Biometals 8(2):129-36


RegulonDB