RegulonDB RegulonDB 10.6.3: Gene Form
   

fes gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fepA fes ybdZ entF CRP H-NS Fur Fur Fur Fur Fur FNR terminator fesp fesp fepAp fepAp entDp1 entDp1

Gene      
Name: fes    Texpresso search in the literature
Synonym(s): ECK0577, EG10299, b0585
Genome position(nucleotides): 612737 --> 613939 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.95
External database links:  
ASAP:
ABE-0002019
CGSC:
780
ECHOBASE:
EB0295
ECOCYC:
EG10299
ECOLIHUB:
fes
OU-MICROARRAY:
b0585
REGULONDB:
b0585
STRING:
511145.b0585
M3D: fes
COLOMBOS: fes
PortEco: b0585


Product      
Name: ferric enterobactin esterase
Synonym(s): Fes, enterochelin esterase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 45.652
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
172 -> 391 SERLKKSRRVWIFTTGDATAEERPLAVLLDGEFWAQSMPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKAIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRGGQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLMQGLIDL
29 -> 155 EVTFWWRDPQGSEEYSTIKRVWVYITGVTDHHQNSQPQSMQRIAGTNVWQWTTQLNANWRGSYCFIPTERDDIFSVPSPDRLELREGWRKLLPQAIADPLNLQSWKGGRGHAVSALEMPQAPLQPGW

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.19 - incorporation of metal ions
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005506 - iron ion binding
GO:0008849 - enterochelin esterase activity
biological_process GO:0006811 - ion transport
GO:0006826 - iron ion transport
GO:0055072 - iron ion homeostasis
GO:0033214 - siderophore-dependent iron import into cell
GO:0046214 - enterobactin catabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Blank D., et al., 2014
[2] Bryce GF., et al., 1972
[3] Konisky J., et al., 1976
[4] Krug K., et al., 2013
[5] Laird AJ., et al., 1980
[6] Plaha DS., et al., 1987
[7] Porra RJ., et al., 1972
[8] Smith BA., et al., 2015
[9] Wayne R., et al., 1976
[10] Zheng T., et al., 2012
External database links:  
DIP:
DIP-9598N
ECOCYC:
EG10299-MONOMER
ECOLIWIKI:
b0585
INTERPRO:
IPR029058
INTERPRO:
IPR021764
INTERPRO:
IPR014756
INTERPRO:
IPR000801
INTERPRO:
IPR013783
MODBASE:
P13039
PFAM:
PF11806
PFAM:
PF00756
PRIDE:
P13039
PRODB:
PRO_000022606
PROTEINMODELPORTAL:
P13039
REFSEQ:
NP_415117
SMR:
P13039
SWISSMODEL:
P13039
UNIPROT:
P13039


Operon      
Name: fes-ybdZ-entF-fepE         
Operon arrangement:
Transcription unit        Promoter
fes-ybdZ-entF-fepE


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, H-NS
Repressed by: Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter entDp1 610254 reverse Similarity to the consensus
Read more >
[ICWHO] [11]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Blank D., Wolf L., Ackermann M., Silander OK., 2014, The predictability of molecular evolution during functional innovation., Proc Natl Acad Sci U S A 111(8):3044-9

 [2] Bryce GF., Brot N., 1972, Studies on the enzymatic synthesis of the cyclic trimer of 2,3-dihydroxy-N-benzoyl-L-serine in Escherichia coli., Biochemistry 11(9):1708-15

 [3] Konisky J., Soucek S., Frick K., Davies JK., Hammond C., 1976, Relationship between the transport of iron and the amount of specific colicin Ia membrane receptors in Escherichia coli., J Bacteriol 127(1):249-57

 [4] Krug K., Carpy A., Behrends G., Matic K., Soares NC., Macek B., 2013, Deep coverage of the Escherichia coli proteome enables the assessment of false discovery rates in simple proteogenomic experiments., Mol Cell Proteomics 12(11):3420-30

 [5] Laird AJ., Ribbons DW., Woodrow GC., Young IG., 1980, Bacteriophage Mu-mediated gene transposition and in vitro cloning of the enterochelin gene cluster of Escherichia coli., Gene 11(3-4):347-57

 [6] Plaha DS., Rogers HJ., 1987, Effect of osmotic shock and shearing forces on ferric enterochelin transport in Escherichia coli K12., J Gen Microbiol 133 ( Pt 5):1227-34

 [7] Porra RJ., Langman L., Young IG., Gibson F., 1972, The role of ferric enterochelin esterase in enterochelin-mediated iron transport and ferrochelatase activity in Escherichia coli., Arch Biochem Biophys 153(1):74-8

 [8] Smith BA., Mularz AE., Hecht MH., 2015, Divergent evolution of a bifunctional de novo protein., Protein Sci 24(2):246-52

 [9] Wayne R., Frick K., Neilands JB., 1976, Siderophore protection against colicins M, B, V, and Ia in Escherichia coli., J Bacteriol 126(1):7-12

 [10] Zheng T., Bullock JL., Nolan EM., 2012, Siderophore-mediated cargo delivery to the cytoplasm of Escherichia coli and Pseudomonas aeruginosa: syntheses of monofunctionalized enterobactin scaffolds and evaluation of enterobactin-cargo conjugate uptake., J Am Chem Soc 134(44):18388-400

 [11] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB