RegulonDB RegulonDB 10.7: Gene Form
   

fhlA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fhlA hypE ygbA hypD OxyS OxyS terminator

Gene      
Name: fhlA    Texpresso search in the literature
Synonym(s): ECK2726, EG10301, b2731, fhl
Genome position(nucleotides): 2854338 --> 2856416 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.57
External database links:  
ASAP:
ABE-0008971
CGSC:
18370
ECHOBASE:
EB0297
OU-MICROARRAY:
b2731
PORTECO:
fhlA
REGULONDB:
b2731
STRING:
511145.b2731
M3D: fhlA
COLOMBOS: fhlA
PortEco: b2731


Shine dalgarno      
Sequence: tgctttcctgGAAGAAcaaaATG


Product      
Name: DNA-binding transcriptional activator FhlA
Synonym(s): Fhl, FhlA, formate hydrogen-lyase transcriptional activator for fdhF, hyc and hyp operons
Sequence: Get amino acid sequence Fasta Format
Regulator Family: EBP
Cellular location: cytosol
Molecular weight: 78.468
Isoelectric point: 5.321
Motif(s):
 
Type Positions Sequence
409 -> 416 GETGTGKE
202 -> 344 DMDELVSEVAKEIHYYFDIDDISIVLRSHRKNKLNIYSTHYLDKQHPAHEQSEVDEAGTLTERVFKSKEMLLINLHERDDLAPYERMLFDTWGNQIQTLCLLPLMSGDTMLGVLKLAQCEEKVFTTTNLNLLRQIAERVAIAV
663 -> 682 PKGAAQRLGLKRTTLLSRMK
666 -> 666 A
284 -> 333 PYERMLFDTWGNQIQTLCLLPLMSGDTMLGVLKLAQCEEKVFTTTNLNLL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005667 - transcription factor complex
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0008134 - transcription factor binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0043565 - sequence-specific DNA binding
GO:0042802 - identical protein binding
GO:0000986 - bacterial-type cis-regulatory region sequence-specific DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
GO:2000144 - positive regulation of DNA-templated transcription, initiation
Reference(s): [1] Maupin JA., et al., 1990
[2] Schlensog V., et al., 1990
[3] Schlensog V., et al., 1994
External database links:  
ECOCYC:
PD02936
ECOLIWIKI:
b2731
INTERPRO:
IPR025944
INTERPRO:
IPR025662
INTERPRO:
IPR002197
INTERPRO:
IPR003018
INTERPRO:
IPR003593
INTERPRO:
IPR009057
INTERPRO:
IPR027417
INTERPRO:
IPR029016
INTERPRO:
IPR002078
MODBASE:
P19323
PFAM:
PF00158
PFAM:
PF01590
PFAM:
PF02954
PRIDE:
P19323
PRINTS:
PR01590
PRODB:
PRO_000022608
PROSITE:
PS00688
PROSITE:
PS50045
PROSITE:
PS00675
PROTEINMODELPORTAL:
P19323
REFSEQ:
NP_417211
SMART:
SM00065
SMART:
SM00382
SMR:
P19323
SWISSMODEL:
P19323
UNIPROT:
P19323


Operon      
Name: hypABCDE-fhlA         
Operon arrangement:
Transcription unit        Promoter
hypABCDE
hypABCDE-fhlA
hypBCDE
hypBCDE-fhlA


Transcriptional Regulation      
Display Regulation             
Activated by: FhlA, FNR, IHF
Repressed by: NsrR


RNA cis-regulatory element    
Attenuation: Translational


Regulation by small RNA    
  Display Regulation
small RNA oxyS, oxyS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Maupin JA., Shanmugam KT., 1990, Genetic regulation of formate hydrogenlyase of Escherichia coli: role of the fhlA gene product as a transcriptional activator for a new regulatory gene, fhlB., J Bacteriol 172(9):4798-806

 [2] Schlensog V., Bock A., 1990, Identification and sequence analysis of the gene encoding the transcriptional activator of the formate hydrogenlyase system of Escherichia coli., Mol Microbiol 4(8):1319-27

 [3] Schlensog V., Lutz S., Bock A., 1994, Purification and DNA-binding properties of FHLA, the transcriptional activator of the formate hydrogenlyase system from Escherichia coli., J Biol Chem 269(30):19590-6


RegulonDB