RegulonDB RegulonDB 10.8: Gene Form
   

fhuE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fhuE ptsG hinT Fur Fur SgrS TSS_1435 TSS_1435 TSS_1434 TSS_1434 hinTp3 hinTp3 TSS_1433 TSS_1433 hinTp2 hinTp2 hinTp1 hinTp1 fhuEp fhuEp TSS_1432 (cluster) TSS_1432 (cluster) TSS_1431 TSS_1431 TSS_1430 TSS_1430 TSS_1429 (cluster) TSS_1429 (cluster) TSS_1428 TSS_1428 TSS_1427 TSS_1427 TSS_1426 (cluster) TSS_1426 (cluster) TSS_1425 (cluster) TSS_1425 (cluster) TSS_1424 TSS_1424 TSS_1423 TSS_1423

Gene      
Name: fhuE    Texpresso search in the literature
Synonym(s): ECK1088, EG10306, b1102
Genome position(nucleotides): 1159362 <-- 1161551 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.0
External database links:  
ASAP:
ABE-0003724
CGSC:
18367
ECHOBASE:
EB0302
OU-MICROARRAY:
b1102
PortEco:
fhuE
STRING:
511145.b1102
COLOMBOS: fhuE


Product      
Name: ferric coprogen/ferric rhodotorulic acid outer membrane transporter
Synonym(s): FhuE, ferric coprogen outer membrane receptor
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 81.232
Isoelectric point: 4.52
Motif(s):
 
Type Positions Sequence
75 -> 175 QRDIPQSVTIVSQQRMEDQQLQTLGEVMENTLGISKSQADSDRALYYSRGFQIDNYMVDGIPTYFESRWNLGDALSDMALFERVEVVRGATGLMTGTGNPS
44 -> 44 V
46 -> 46 V
273 -> 727 PTWGGLPRWNTDGSSNSYDRARSTAPDWAYNDKEINKVFMTLKQQFADTWQATLNATHSEVEFDSKMMYVDAYVNKADGMLVGPYSNYGPGFDYVGGTGWNSGKRKVDALDLFADGSYELFGRQHNLMFGGSYSKQNNRYFSSWANIFPDEIGSFYNFNGNFPQTDWSPQSLAQDDTTHMKSLYAATRVTLADPLHLILGARYTNWRVDTLTYSMEKNHTTPYAGLVFDINDNWSTYASYTSIFQPQNDRDSSGKYLAPITGNNYELGLKSDWMNSRLTTTLAIFRIEQDNVAQSTGTPIPGSNGETAYKAVDGTVSKGVEFELNGAITDNWQLTFGATRYIAEDNEGNAVNPNLPRTTVKMFTSYRLPVMPELTVGGGVNWQNRVYTDTVTPYGTFRAEQGSYALVDLFTRYQVTKNFSLQGNVNNLFDKTYDTNVEGSIVYGTPRNFSITGTY
163 -> 163 G

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.19 - incorporation of metal ions
  4 - transport --> 4.1 - Channel-type Transporters --> 4.1.B - Beta barrel porins (The Outer Membrane Porin (OMP) Functional Superfamily)
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
molecular_function GO:0038023 - signaling receptor activity
GO:0015344 - siderophore uptake transmembrane transporter activity
biological_process GO:0006811 - ion transport
GO:0055072 - iron ion homeostasis
GO:0015891 - siderophore transport
GO:0044718 - siderophore transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG10306-MONOMER
ECOLIWIKI:
b1102
INTERPRO:
IPR000531
INTERPRO:
IPR036942
INTERPRO:
IPR012910
INTERPRO:
IPR039423
INTERPRO:
IPR037066
INTERPRO:
IPR010105
INTERPRO:
IPR010916
INTERPRO:
IPR010917
MODBASE:
P16869
PANTHER:
PTHR32552
PDB:
6E4V
PFAM:
PF00593
PFAM:
PF07715
PRIDE:
P16869
PRODB:
PRO_000022613
PROSITE:
PS01156
PROSITE:
PS00430
REFSEQ:
NP_415620
SMR:
P16869
UNIPROT:
P16869


Operon      
Name: fhuE         
Operon arrangement:
Transcription unit        Promoter
fhuE


Transcriptional Regulation      
Display Regulation             
Repressed by: Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1423 1158280 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1424 1158634 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1425 (cluster) 1158640 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1426 (cluster) 1158878 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1427 1158897 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1428 1158901 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1429 (cluster) 1158904 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1430 1158907 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1431 1159132 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1432 (cluster) 1159175 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter hinTp1 1161821 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter hinTp2 1161823 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1433 1161825 forward nd [RS-EPT-CBR] [1]
  promoter hinTp3 1161827 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1434 1161832 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1435 1161855 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB