RegulonDB RegulonDB 10.6.3: Gene Form
   

fimA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fimE fimA fimI Lrp Lrp Lrp IHF IHF TSS_5136 TSS_5136 TSS_5135 TSS_5135 TSS_5134 TSS_5134 TSS_5133 (cluster) TSS_5133 (cluster) TSS_5132 TSS_5132 fimAp fimAp

Gene      
Name: fimA    Texpresso search in the literature
Synonym(s): ECK4305, EG10308, b4314, fimD, pilA
Genome position(nucleotides): 4543115 --> 4543663 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.73
External database links:  
ASAP:
ABE-0014145
CGSC:
18358
ECHOBASE:
EB0304
ECOCYC:
EG10308
ECOLIHUB:
fimA
OU-MICROARRAY:
b4314
REGULONDB:
b4314
STRING:
511145.b4314
M3D: fimA
COLOMBOS: fimA
PortEco: b4314


Product      
Name: type 1 fimbriae major subunit
Synonym(s): FimA, FimD, PilA
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,pilus
Molecular weight: 18.111
Isoelectric point: 4.952
Motif(s):
 
Type Positions Sequence
20 -> 20 A
34 -> 182 HFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ
1 -> 23 MKIKTLAIVVLSALSLSSTAALA
24 -> 182 AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ
163 -> 163 T

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
GO:0005576 - extracellular region
molecular_function GO:0042802 - identical protein binding
biological_process GO:0007155 - cell adhesion
GO:0043711 - pilus organization
GO:0043709 - cell adhesion involved in single-species biofilm formation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9609N
ECOCYC:
EG10308-MONOMER
ECOLIWIKI:
b4314
INTERPRO:
IPR036937
INTERPRO:
IPR008966
INTERPRO:
IPR000259
MODBASE:
P04128
PDB:
6C53
PDB:
5OH0
PDB:
5NKT
PDB:
4DWH
PDB:
3SQB
PDB:
2N7H
PDB:
2M5G
PDB:
2JTY
PFAM:
PF00419
PRIDE:
P04128
PRODB:
PRO_000022616
PROTEINMODELPORTAL:
P04128
REFSEQ:
NP_418734
SMR:
P04128
UNIPROT:
P04128


Operon      
Name: fimAICDFGH         
Operon arrangement:
Transcription unit        Promoter
fimAICDFGH


Transcriptional Regulation      
Display Regulation             
Activated by: H-NS, IHF, Lrp


Regulation by small RNA    
  Display Regulation
small RNA omrA, omrB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5132 4542983 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5133 (cluster) 4543095 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_5134 4543103 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5135 4543121 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5136 4543128 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB