RegulonDB RegulonDB 10.6.3: Gene Form
   

fimC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fimD fimC fimI terminator anti-terminator TSS_5140 TSS_5140 TSS_5139 TSS_5139 TSS_5138 TSS_5138 TSS_5137 TSS_5137

Gene      
Name: fimC    Texpresso search in the literature
Synonym(s): ECK4307, EG10310, b4316, pilB
Genome position(nucleotides): 4544304 --> 4545029 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.49
External database links:  
ASAP:
ABE-0014149
CGSC:
18352
ECHOBASE:
EB0306
ECOCYC:
EG10310
ECOLIHUB:
fimC
OU-MICROARRAY:
b4316
REGULONDB:
b4316
STRING:
511145.b4316
M3D: fimC
COLOMBOS: fimC
PortEco: b4316


Product      
Name: type 1 fimbriae periplasmic chaperone
Synonym(s): FimC, PilB
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 26.689
Isoelectric point: 9.809
Motif(s):
 
Type Positions Sequence
210 -> 210 T
1 -> 36 MSNKNVNVRKSQEITFCLLAGILMFMAMMVAGRAEA
54 -> 54 E
180 -> 233 NPTPYYLTVTELNAGTRVLENALVPPMGESTVKLPSDAGSNITYRTINDYGALT
29 -> 29 M

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0005515 - protein binding
GO:0044183 - protein folding chaperone
biological_process GO:0043711 - pilus organization
GO:0071555 - cell wall organization
GO:0061077 - chaperone-mediated protein folding
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Barnhart MM., et al., 2000
[2] Choudhury D., et al., 1999
[3] Hermanns U., et al., 2000
[4] Pellecchia M., et al., 1999
External database links:  
DIP:
DIP-9611N
ECOCYC:
EG10310-MONOMER
ECOLIWIKI:
b4316
INTERPRO:
IPR016147
INTERPRO:
IPR008962
INTERPRO:
IPR036316
INTERPRO:
IPR018046
INTERPRO:
IPR016148
INTERPRO:
IPR001829
INTERPRO:
IPR013783
MINT:
P31697
MODBASE:
P31697
PDB:
1KLF
PDB:
1QUN
PDB:
1ZE3
PDB:
1KIU
PDB:
1BF8
PDB:
4DWH
PDB:
4J3O
PDB:
3SQB
PDB:
6E14
PDB:
6E15
PDB:
3BWU
PDB:
3JWN
PDB:
3RFZ
PFAM:
PF02753
PFAM:
PF00345
PRIDE:
P31697
PRINTS:
PR00969
PRODB:
PRO_000022618
PROSITE:
PS00635
PROTEINMODELPORTAL:
P31697
REFSEQ:
NP_418736
SMR:
P31697
UNIPROT:
P31697


Operon      
Name: fimAICDFGH         
Operon arrangement:
Transcription unit        Promoter
fimAICDFGH


Transcriptional Regulation      
Display Regulation             
Activated by: H-NS, IHF, Lrp


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5137 4544668 forward nd [RS-EPT-CBR] [5]
  promoter TSS_5138 4544808 forward nd [RS-EPT-CBR] [5]
  promoter TSS_5139 4545062 forward nd [RS-EPT-CBR] [5]
  promoter TSS_5140 4545183 forward nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Barnhart MM., Pinkner JS., Soto GE., Sauer FG., Langermann S., Waksman G., Frieden C., Hultgren SJ., 2000, PapD-like chaperones provide the missing information for folding of pilin proteins., Proc Natl Acad Sci U S A 97(14):7709-14

 [2] Choudhury D., Thompson A., Stojanoff V., Langermann S., Pinkner J., Hultgren SJ., Knight SD., 1999, X-ray structure of the FimC-FimH chaperone-adhesin complex from uropathogenic Escherichia coli., Science 285(5430):1061-6

 [3] Hermanns U., Sebbel P., Eggli V., Glockshuber R., 2000, Characterization of FimC, a periplasmic assembly factor for biogenesis of type 1 pili in Escherichia coli., Biochemistry 39(38):11564-70

 [4] Pellecchia M., Sebbel P., Hermanns U., Wuthrich K., Glockshuber R., 1999, Pilus chaperone FimC-adhesin FimH interactions mapped by TROSY-NMR., Nat Struct Biol 6(4):336-9

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB