RegulonDB RegulonDB 10.6.3: Gene Form
   

fimD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fimD fimC fimF terminator anti-terminator TSS_5141 TSS_5141 TSS_5140 TSS_5140 TSS_5139 TSS_5139 TSS_5138 TSS_5138 TSS_5137 TSS_5137

Gene      
Name: fimD    Texpresso search in the literature
Synonym(s): ECK4308, EG10311, b4317, fimD_1, fimD_2
Genome position(nucleotides): 4545096 --> 4547732 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.62
External database links:  
ASAP:
ABE-0014151
CGSC:
18349
ECHOBASE:
EB0307
ECOCYC:
EG10311
ECOLIHUB:
fimD
OU-MICROARRAY:
b4317
REGULONDB:
b4317
STRING:
511145.b4317
M3D: fimD
COLOMBOS: fimD
PortEco: b4317


Product      
Name: type I fimbriae usher protein
Synonym(s): FimD, FimD_1, FimD_2
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 96.482
Isoelectric point: 7.117
Motif(s):
 
Type Positions Sequence
352 -> 402 DGSTQIFTVPYSSVPLLQREGHTRYSITAGEYRSGNAQQEKTRFFQSTLLH
658 -> 670 GGDGNSGSTGYAT
799 -> 863 LMTLTHNNKPLPFGAMVTSESSQSSGIVADNGQVYLSGMPLAGKVQVKWGEEENAHCVANYQLPP
811 -> 811 F
723 -> 742 APGAKDAKVENQTGVRTDWR

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0015473 - fimbrial usher porin activity
biological_process GO:0009297 - pilus assembly
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9612N
ECOCYC:
EG10311-MONOMER
ECOLIWIKI:
b4317
INTERPRO:
IPR037224
INTERPRO:
IPR025949
INTERPRO:
IPR025885
INTERPRO:
IPR018030
INTERPRO:
IPR000015
MINT:
P30130
PANTHER:
PTHR30451
PDB:
3BWU
PDB:
3RFZ
PDB:
3OHN
PDB:
1ZDX
PDB:
4J3O
PDB:
1ZE3
PDB:
1ZDV
PFAM:
PF13954
PFAM:
PF00577
PFAM:
PF13953
PRIDE:
P30130
PRODB:
PRO_000022619
PROSITE:
PS01151
PROTEINMODELPORTAL:
P30130
REFSEQ:
NP_418737
SMR:
P30130
UNIPROT:
P30130


Operon      
Name: fimAICDFGH         
Operon arrangement:
Transcription unit        Promoter
fimAICDFGH


Transcriptional Regulation      
Display Regulation             
Activated by: H-NS, IHF, Lrp


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5137 4544668 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5138 4544808 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5139 4545062 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5140 4545183 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5141 4547980 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB