RegulonDB RegulonDB 10.6.3: Gene Form
   

fimG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fimH fimF fimG TSS_5141 TSS_5141

Gene      
Name: fimG    Texpresso search in the literature
Synonym(s): ECK4310, EG10314, b4319
Genome position(nucleotides): 4548285 --> 4548788 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.38
External database links:  
ASAP:
ABE-0014155
ECHOBASE:
EB0310
ECOCYC:
EG10314
ECOLIHUB:
fimG
OU-MICROARRAY:
b4319
REGULONDB:
b4319
STRING:
511145.b4319
M3D: fimG
COLOMBOS: fimG
PortEco: b4319


Product      
Name: type 1 fimbriae minor subunit FimG
Synonym(s): FimG
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,pilus
Molecular weight: 17.317
Isoelectric point: 5.614
Motif(s):
 
Type Positions Sequence
1 -> 23 MKWCKRGYVLAAILALASATIQA
24 -> 167 ADVTITVNGKVVAKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVTASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQSAHFPLQVRALTVNGGATQGTIQAVISITYTYS
148 -> 149 NG
61 -> 61 A

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
GO:0005576 - extracellular region
molecular_function GO:0005515 - protein binding
biological_process GO:0007155 - cell adhesion
GO:0043711 - pilus organization
GO:0043709 - cell adhesion involved in single-species biofilm formation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9615N
ECOCYC:
EG10314-MONOMER
ECOLIWIKI:
b4319
INTERPRO:
IPR036937
INTERPRO:
IPR008966
MODBASE:
P08190
PDB:
3BFQ
PDB:
6E15
PDB:
6E14
PDB:
5IQO
PDB:
5IQN
PDB:
5IQM
PDB:
3BFW
PDB:
3JWN
PDB:
4J3O
PDB:
4XO9
PDB:
4XOA
PDB:
4XOD
PRIDE:
P08190
PRODB:
PRO_000022622
PROTEINMODELPORTAL:
P08190
REFSEQ:
NP_418739
SMR:
P08190
UNIPROT:
P08190


Operon      
Name: fimAICDFGH         
Operon arrangement:
Transcription unit        Promoter
fimAICDFGH


Transcriptional Regulation      
Display Regulation             
Activated by: H-NS, IHF, Lrp


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5141 4547980 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB