RegulonDB RegulonDB 10.6.3: Gene Form
   

fimH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gntP fimH fimG

Gene      
Name: fimH    Texpresso search in the literature
Synonym(s): ECK4311, EG10315, b4320, pilE
Genome position(nucleotides): 4548808 --> 4549710 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.17
External database links:  
ASAP:
ABE-0014157
CGSC:
18337
ECHOBASE:
EB0311
ECOCYC:
EG10315
ECOLIHUB:
fimH
OU-MICROARRAY:
b4320
REGULONDB:
b4320
STRING:
511145.b4320
M3D: fimH
COLOMBOS: fimH
PortEco: b4320


Product      
Name: type 1 fimbriae D-mannose specific adhesin
Synonym(s): FimH, PilE, type 1 fimbrin minor protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,pilus
Molecular weight: 31.473
Isoelectric point: 7.878
Motif(s):
 
Type Positions Sequence
197 -> 197 P
79 -> 79 L
176 -> 300 VVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
1 -> 21 MKRVITLFAVLLMGWSVNAWS
222 -> 222 T

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.11 - glycoprotein
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
GO:0005576 - extracellular region
GO:0033644 - host cell membrane
molecular_function GO:0005515 - protein binding
GO:0005537 - mannose binding
biological_process GO:0007155 - cell adhesion
GO:0043711 - pilus organization
GO:0043709 - cell adhesion involved in single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [APPPINH] Assay of protein partially-purified from its native host
[IMP] Inferred from mutant phenotype
Reference(s): [1] Krogfelt KA., et al., 1990
[2] Sokurenko EV., et al., 1994
External database links:  
DIP:
DIP-9616N
ECOCYC:
EG10315-MONOMER
ECOLIWIKI:
b4320
INTERPRO:
IPR036937
INTERPRO:
IPR015243
INTERPRO:
IPR000259
INTERPRO:
IPR008966
MODBASE:
P08191
PDB:
4CST
PDB:
6E14
PDB:
5MUC
PDB:
5MTS
PDB:
5MCA
PDB:
5L4Y
PDB:
5L4X
PDB:
5L4W
PDB:
1KIU
PDB:
1KLF
PDB:
1QUN
PDB:
1TR7
PDB:
1UWF
PDB:
1ZE3
PDB:
2VCO
PDB:
3RFZ
PDB:
3ZL1
PDB:
3ZL2
PDB:
4ATT
PDB:
4AUJ
PDB:
4AUU
PDB:
4AUY
PDB:
4AV0
PDB:
4AV4
PDB:
4AV5
PDB:
4AVH
PDB:
4AVI
PDB:
4AVJ
PDB:
4AVK
PDB:
4CSS
PDB:
6E15
PDB:
4J3O
PDB:
4LOV
PDB:
4X50
PDB:
4X5P
PDB:
4X5Q
PDB:
4X5R
PDB:
4XO8
PDB:
4XO9
PDB:
4XOA
PDB:
4XOB
PDB:
4XOD
PDB:
5AB1
PDB:
5ABZ
PDB:
5CGB
PDB:
5F2F
PDB:
5F3F
PDB:
5FWR
PDB:
5FX3
PDB:
5JCQ
PDB:
5JCR
PDB:
5L4T
PDB:
5L4U
PDB:
5L4V
PFAM:
PF09160
PFAM:
PF00419
PRIDE:
P08191
PRODB:
PRO_000022623
PROTEINMODELPORTAL:
P08191
REFSEQ:
NP_418740
SMR:
P08191
UNIPROT:
P08191


Operon      
Name: fimAICDFGH         
Operon arrangement:
Transcription unit        Promoter
fimAICDFGH


Transcriptional Regulation      
Display Regulation             
Activated by: H-NS, IHF, Lrp


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Krogfelt KA., Bergmans H., Klemm P., 1990, Direct evidence that the FimH protein is the mannose-specific adhesin of Escherichia coli type 1 fimbriae., Infect Immun 58(6):1995-8

 [2] Sokurenko EV., Courtney HS., Ohman DE., Klemm P., Hasty DL., 1994, FimH family of type 1 fimbrial adhesins: functional heterogeneity due to minor sequence variations among fimH genes., J Bacteriol 176(3):748-55


RegulonDB