RegulonDB RegulonDB 10.8: Gene Form
   

lpxD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lpxD skp fabZ TSS_377 TSS_377 TSS_376 TSS_376 TSS_375 TSS_375 TSS_374 TSS_374 TSS_373 (cluster) TSS_373 (cluster) TSS_372 (cluster) TSS_372 (cluster) TSS_371 (cluster) TSS_371 (cluster) TSS_370 (cluster) TSS_370 (cluster) TSS_369 (cluster) TSS_369 (cluster) TSS_368 TSS_368 TSS_367 TSS_367 lpxDp lpxDp

Gene      
Name: lpxD    Texpresso search in the literature
Synonym(s): ECK0178, EG10316, b0179, firA, omsA
Genome position(nucleotides): 200971 --> 201996 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.83
External database links:  
ASAP:
ABE-0000610
CGSC:
775
ECHOBASE:
EB0312
OU-MICROARRAY:
b0179
PortEco:
lpxD
STRING:
511145.b0179
COLOMBOS: lpxD


Product      
Name: UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase
Synonym(s): FirA, LpxD, OmsA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.038
Isoelectric point: 6.504
Motif(s):
 
Type Positions Sequence
165 -> 165 Q
228 -> 228 G
292 -> 292 M
41 -> 41 F
2 -> 341 PSIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSAVIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTIIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLERKVNQQD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.3 - lipid A
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016410 - N-acyltransferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0016747 - transferase activity, transferring acyl groups other than amino-acyl groups
GO:0042802 - identical protein binding
GO:0103118 - UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase activity
biological_process GO:0006629 - lipid metabolic process
GO:0009245 - lipid A biosynthetic process
GO:0046677 - response to antibiotic
External database links:  
DIP:
DIP-10124N
ECOCYC:
UDPHYDROXYMYRGLUCOSAMNACETYLTRANS-MONO
ECOLIWIKI:
b0179
INTERPRO:
IPR020573
INTERPRO:
IPR001451
INTERPRO:
IPR018357
INTERPRO:
IPR011004
INTERPRO:
IPR007691
MINT:
MINT-1218299
MODBASE:
P21645
PANTHER:
PTHR43378
PDB:
4IHH
PDB:
4IHG
PDB:
4IHF
PDB:
3EH0
PFAM:
PF14602
PFAM:
PF00132
PFAM:
PF04613
PRIDE:
P21645
PRODB:
PRO_000023123
PROSITE:
PS00101
REFSEQ:
NP_414721
SMR:
P21645
UNIPROT:
P21645


Operon      
Name: bamA-skp-lpxD-fabZ-lpxAB-rnhB-dnaE         
Operon arrangement:
Transcription unit        Promoter
bamA-hlpA-lpxD-fabZ-lpxAB-rnhB-dnaE
bamA
hlpA-lpxD-fabZ-lpxA
lpxD
fabZ


Transcriptional Regulation      
Display Regulation             
Activated by: CpxR, GadE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_367 201749 forward nd [RS-EPT-CBR] [1]
  promoter TSS_368 201767 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_369 (cluster) 202019 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_370 (cluster) 202063 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_371 (cluster) 202070 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_372 (cluster) 202078 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_373 (cluster) 202081 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_374 202087 forward nd [RS-EPT-CBR] [1]
  promoter TSS_375 202110 forward nd [RS-EPT-CBR] [1]
  promoter TSS_376 202370 forward nd [RS-EPT-CBR] [1]
  promoter TSS_377 202372 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB