RegulonDB RegulonDB 10.8: Gene Form
   

flhD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insAB5 flhC insB5 flhD insA5 OmpR LrhA IHF CRP AcrR YjjQ RcsAB FliZ OmpR Fur CpxR anti-anti-terminator anti-terminator terminator TSS_2232 TSS_2232 flhDp2 flhDp2 flhDp flhDp flhCp3 flhCp3 motAp motAp TSS_2231 TSS_2231

Gene      
Name: flhD    Texpresso search in the literature
Synonym(s): ECK1893, EG10320, b1892, flbB
Genome position(nucleotides): 1977847 <-- 1978197 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.44
External database links:  
ASAP:
ABE-0006303
CGSC:
749
ECHOBASE:
EB0316
OU-MICROARRAY:
b1892
PortEco:
flhD
STRING:
511145.b1892
COLOMBOS: flhD


Product      
Name: DNA-binding transcriptional dual regulator FlhD
Synonym(s): FlbB, FlhD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.316
Isoelectric point: 7.073
Motif(s):
 
Type Positions Sequence
1 -> 100 MHTSELLKHIYDINLSYLLLAQRLIVQDKASAMFRLGINEEMATTLAALTLPQMVKLAETNQLVCHFRFDSHQTITQLTQDSRVDDLQQIHTGIMLSTRL
92 -> 92 T
84 -> 84 V
2 -> 2 H
34 -> 34 F

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0044780 - bacterial-type flagellum assembly
GO:0044781 - bacterial-type flagellum organization
GO:1902208 - regulation of bacterial-type flagellum assembly
Reference(s): [1] Claret L., et al., 2002
[2] Liu X., et al., 1994
External database links:  
DIP:
DIP-9646N
ECOCYC:
EG10320-MONOMER
ECOLIWIKI:
b1892
INTERPRO:
IPR023559
INTERPRO:
IPR036194
MODBASE:
P0A8S9
PDB:
4ES4
PDB:
2AVU
PDB:
1G8E
PFAM:
PF05247
PRIDE:
P0A8S9
PRODB:
PRO_000022653
PRODOM:
PD015582
REFSEQ:
NP_416406
SMR:
P0A8S9
UNIPROT:
P0A8S9


Operon      
Name: flhDC         
Operon arrangement:
Transcription unit        Promoter
flhDC
flhDC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, H-NS, QseB
Repressed by: HdfR, FliZ, OmpR, Fur, YjjQ, LrhA, MatA, IHF, RcsAB, AcrR


RNA cis-regulatory element    
Attenuation: Translational


Regulation by small RNA    
  Display Regulation
small RNA mcaS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2231 1977300 reverse nd [RS-EPT-CBR] [3]
  promoter flhCp3 1977932 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Claret L., Hughes C., 2002, Interaction of the atypical prokaryotic transcription activator FlhD2C2 with early promoters of the flagellar gene hierarchy., J Mol Biol 321(2):185-99

 [2] Liu X., Matsumura P., 1994, The FlhD/FlhC complex, a transcriptional activator of the Escherichia coli flagellar class II operons., J Bacteriol 176(23):7345-51

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB