RegulonDB RegulonDB 10.6.3: Gene Form
   

fliC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fliC fliD fliA FlhDC FlhDC NsrR IHF IHF FlhDC FlhDC CsgD NsrR anti-anti-terminator anti-terminator terminator TSS_2265 TSS_2265 fliDp fliDp fliCp fliCp TSS_2264 TSS_2264 TSS_2263 TSS_2263 TSS_2262 TSS_2262 TSS_2261 TSS_2261 fliAp1 fliAp1 fliAp2 fliAp2 TSS_2259 TSS_2259 TSS_2258 TSS_2258

Gene      
Name: fliC    Texpresso search in the literature
Synonym(s): ECK1922, EG10321, H, b1923, flaF, hag
Genome position(nucleotides): 2002110 <-- 2003606 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.49
External database links:  
ASAP:
ABE-0006402
CGSC:
649
ECHOBASE:
EB0317
ECOCYC:
EG10321
ECOLIHUB:
fliC
OU-MICROARRAY:
b1923
REGULONDB:
b1923
STRING:
511145.b1923
M3D: fliC
COLOMBOS: fliC
PortEco: b1923


Product      
Name: flagellar filament structural protein
Synonym(s): FlaF, FliC, Hag, flagellin
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,cell projection
Molecular weight: 51.295
Isoelectric point: 4.291
Motif(s):
 
Type Positions Sequence
2 -> 498 AQVINTNSLSLITQNNINKNQSALSSSIERLSSGLRINSAKDDAAGQAIANRFTSNIKGLTQAARNANDGISVAQTTEGALSEINNNLQRVRELTVQATTGTNSESDLSSIQDEIKSRLDEIDRVSGQTQFNGVNVLAKNGSMKIQVGANDNQTITIDLKQIDAKTLGLDGFSVKNNDTVTTSAPVTAFGATTTNNIKLTGITLSTEAATDTGGTNPASIEGVYTDNGNDYYAKITGGDNDGKYYAVTVANDGTVTMATGATANATVTDANTTKATTITSGGTPVQIDNTAGSATANLGAVSLVKLQDSKGNDTDTYALKDTNGNLYAADVNETTGAVSVKTITYTDSSGAASSPTAVKLGGDDGKTEVVDIDGKTYDSADLNGGNLQTGLTAGGEALTAVANGKTTDPLKALDDAIASVDKFRSSLGAVQNRLDSAVTNLNNTTTNLSEAQSRIQDADYATEVSNMSKAQIIQQAGNSVLAKANQVPQQVLSLLQG
198 -> 276 IKLTGITLSTEAATDTGGTNPASIEGVYTDNGNDYYAKITGGDNDGKYYAVTVANDGTVTMATGATANATVTDANTTKA
412 -> 496 KALDDAIASVDKFRSSLGAVQNRLDSAVTNLNNTTTNLSEAQSRIQDADYATEVSNMSKAQIIQQAGNSVLAKANQVPQQVLSLL
5 -> 141 INTNSLSLITQNNINKNQSALSSSIERLSSGLRINSAKDDAAGQAIANRFTSNIKGLTQAARNANDGISVAQTTEGALSEINNNLQRVRELTVQATTGTNSESDLSSIQDEIKSRLDEIDRVSGQTQFNGVNVLAKN
285 -> 285 P

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0005576 - extracellular region
GO:0009288 - bacterial-type flagellum
GO:0009420 - bacterial-type flagellum filament
molecular_function GO:0005198 - structural molecule activity
GO:0005515 - protein binding
biological_process GO:0071973 - bacterial-type flagellum-dependent cell motility
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9649N
ECOCYC:
EG10321-MONOMER
ECOLIWIKI:
b1923
INTERPRO:
IPR014981
INTERPRO:
IPR001492
INTERPRO:
IPR001029
MODBASE:
P04949
PFAM:
PF08884
PFAM:
PF00669
PFAM:
PF00700
PRIDE:
P04949
PRINTS:
PR00207
PRODB:
PRO_000022655
PROTEINMODELPORTAL:
P04949
REFSEQ:
NP_416433
SMR:
P04949
UNIPROT:
P04949


Operon      
Name: fliC         
Operon arrangement:
Transcription unit        Promoter
fliC


Transcriptional Regulation      
Display Regulation             
Activated by: H-NS, GadE
Repressed by: MatA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2258 2001544 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2259 2001807 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2261 2002392 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2262 2002401 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2263 2003300 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2264 2003675 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2265 2003836 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB