RegulonDB RegulonDB 10.8: Gene Form
   

folD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

folD sfmA ybcJ anti-terminator sfmAp6 sfmAp6 sfmAp4 sfmAp4 folDp folDp TSS_679 TSS_679 ybcJp7 ybcJp7 ybcJp5 ybcJp5 ybcJp3 ybcJp3 ybcJp4 ybcJp4

Gene      
Name: folD    Texpresso search in the literature
Synonym(s): ECK0522, EG10328, ads, b0529
Genome position(nucleotides): 556875 <-- 557741 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.33
External database links:  
ASAP:
ABE-0001818
CGSC:
31127
ECHOBASE:
EB0324
NCBI-GENE:
945221
OU-MICROARRAY:
b0529
PortEco:
folD
STRING:
511145.b0529
COLOMBOS: folD


Product      
Name: bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase
Synonym(s): Ads, FolD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.044
Isoelectric point: 5.97
Motif(s):
 
Type Positions Sequence
166 -> 168 GAS
2 -> 288 AAKIIDGKTIAQQVRSEVAQKVQARIAAGLRAPGLAVVLVGSNPASQIYVASKRKACEEVGFVSRSYDLPETTSEAELLELIDTLNADNTIDGILVQLPLPAGIDNVKVLERIHPDKDVDGFHPYNVGRLCQRAPRLRPCTPRGIVTLLERYNIDTFGLNAVVIGASNIVGRPMSMELLLAGCTTTVTHRFTKNLRHHVENADLLIVAVGKPGFIPGDWIKEGAIVIDVGINRLENGKVVGDVVFEDAAKRASYITPVPGGVGPMTVATLIENTLQACVEYHDPQDE
124 -> 279 HPYNVGRLCQRAPRLRPCTPRGIVTLLERYNIDTFGLNAVVIGASNIVGRPMSMELLLAGCTTTVTHRFTKNLRHHVENADLLIVAVGKPGFIPGDWIKEGAIVIDVGINRLENGKVVGDVVFEDAAKRASYITPVPGGVGPMTVATLIENTLQAC
200 -> 200 V
5 -> 121 IIDGKTIAQQVRSEVAQKVQARIAAGLRAPGLAVVLVGSNPASQIYVASKRKACEEVGFVSRSYDLPETTSEAELLELIDTLNADNTIDGILVQLPLPAGIDNVKVLERIHPDKDVD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.2 - folic acid
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.17 - formyl-THF biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0004486 - methylenetetrahydrofolate dehydrogenase [NAD(P)+] activity
GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0016491 - oxidoreductase activity
GO:0004477 - methenyltetrahydrofolate cyclohydrolase activity
GO:0004488 - methylenetetrahydrofolate dehydrogenase (NADP+) activity
biological_process GO:0008152 - metabolic process
GO:0000105 - histidine biosynthetic process
GO:0006164 - purine nucleotide biosynthetic process
GO:0006730 - one-carbon metabolic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0009086 - methionine biosynthetic process
GO:0055114 - oxidation-reduction process
GO:0035999 - tetrahydrofolate interconversion
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9675N
ECOCYC:
FOLD-MONOMER
ECOLIWIKI:
b0529
INTERPRO:
IPR020630
INTERPRO:
IPR036291
INTERPRO:
IPR020867
INTERPRO:
IPR020631
INTERPRO:
IPR000672
MODBASE:
P24186
PANTHER:
PTHR10025
PDB:
5O2A
PDB:
1B0A
PDB:
5O28
PDB:
5O22
PFAM:
PF02882
PFAM:
PF00763
PRIDE:
P24186
PRINTS:
PR00085
PRODB:
PRO_000022679
PROSITE:
PS00766
PROSITE:
PS00767
REFSEQ:
NP_415062
SMR:
P24186
UNIPROT:
P24186


Operon      
Name: folD-ybcJ         
Operon arrangement:
Transcription unit        Promoter
folD-ybcJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybcJp4 556891 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybcJp3 556967 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybcJp5 557006 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybcJp7 557025 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_679 557596 reverse nd [RS-EPT-CBR] [2]
  promoter sfmAp4 558062 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter sfmAp6 558166 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB