RegulonDB RegulonDB 10.9: Gene Form
   

frr gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dxr pyrH frr ppGpp TSS_333 TSS_333 dxrp1 dxrp1 dxrp5 dxrp5 dxrp4 dxrp4 dxrp3 dxrp3 TSS_332 TSS_332 frrp6 frrp6 frrp frrp frrp3 frrp3 TSS_330 TSS_330

Gene      
Name: frr    Texpresso search in the literature
Synonym(s): ECK0171, EG10335, b0172, rrf
Genome position(nucleotides): 192872 --> 193429 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.9
External database links:  
ASAP:
ABE-0000588
CGSC:
30590
ECHOBASE:
EB0331
ECOLIHUB:
frr
OU-MICROARRAY:
b0172
STRING:
511145.b0172
COLOMBOS: frr


Product      
Name: ribosome-recycling factor
Synonym(s): Frr, RF4, RR factor, Rrf, release factor 4, ribosome release factor
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.639
Isoelectric point: 6.868
Motif(s):
 
Type Positions Sequence
20 -> 183 FKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELM

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.1 - translation attenuation and efficiency
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0043023 - ribosomal large subunit binding
biological_process GO:0006412 - translation
GO:0006415 - translational termination
GO:0002184 - cytoplasmic translational termination
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
[IMP] Inferred from mutant phenotype
Reference(s): [1] Dincbas V., et al., 1999
[2] Hirokawa G., et al., 2004
[3] Ichikawa S., et al., 1989
[4] Janosi L., et al., 1998
[5] MacDougall J., et al., 1997
[6] Otaka T., et al., 1983
[7] Ryoji M., et al., 1985
[8] Shimizu I., et al., 1991
[9] Uehara Y., et al., 1976
External database links:  
DIP:
DIP-48120N
ECOCYC:
EG10335-MONOMER
ECOLIWIKI:
b0172
INTERPRO:
IPR036191
INTERPRO:
IPR023584
INTERPRO:
IPR002661
MODBASE:
P0A805
PANTHER:
PTHR20982
PDB:
4WOI
PDB:
4V9D
PDB:
4V9C
PDB:
2RDO
PDB:
1ZN1
PDB:
1ZN0
PDB:
1Y69
PDB:
1ISE
PDB:
1EK8
PFAM:
PF01765
PRIDE:
P0A805
PRODB:
PRO_000022697
REFSEQ:
NP_414714
SMR:
P0A805
UNIPROT:
P0A805


Operon      
Name: frr         
Operon arrangement:
Transcription unit        Promoter
frr


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_330 192617 forward nd [RS-EPT-CBR] [10]
  promoter frrp3 192812 forward Similarity to the consensus
Read more >
[ICWHO] [11]
  promoter frrp6 192849 forward Similarity to the consensus
Read more >
[ICWHO] [11]
  promoter TSS_332 192941 forward nd [RS-EPT-CBR] [10]
  promoter dxrp3 193335 forward Similarity to the consensus
Read more >
[ICWHO] [11]
  promoter dxrp4 193338 forward Similarity to the consensus
Read more >
[ICWHO] [11]
  promoter dxrp5 193411 forward Similarity to the consensus
Read more >
[ICWHO] [11]
  promoter dxrp1 193471 forward Similarity to the consensus
Read more >
[ICWHO] [11]
  promoter TSS_333 194269 forward nd [RS-EPT-CBR] [10]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Dincbas V., Heurgue-Hamard V., Buckingham RH., Karimi R., Ehrenberg M., 1999, Shutdown in protein synthesis due to the expression of mini-genes in bacteria., J Mol Biol 291(4):745-59

 [2] Hirokawa G., Inokuchi H., Kaji H., Igarashi K., Kaji A., 2004, In vivo effect of inactivation of ribosome recycling factor - fate of ribosomes after unscheduled translation downstream of open reading frame., Mol Microbiol 54(4):1011-21

 [3] Ichikawa S., Kaji A., 1989, Molecular cloning and expression of ribosome releasing factor., J Biol Chem 264(33):20054-9

 [4] Janosi L., Mottagui-Tabar S., Isaksson LA., Sekine Y., Ohtsubo E., Zhang S., Goon S., Nelken S., Shuda M., Kaji A., 1998, Evidence for in vivo ribosome recycling, the fourth step in protein biosynthesis., EMBO J 17(4):1141-51

 [5] MacDougall J., Holst-Hansen P., Mortensen KK., Freistroffer DV., Pavlov MY., Ehrenberg M., Buckingham RH., 1997, Purification of active Escherichia coli ribosome recycling factor (RRF) from an osmo-regulated expression system., Biochimie 79(5):243-6

 [6] Otaka T., Kaji A., 1983, Mode of action of bottromycin A2: effect of bottromycin A2 on polysomes., FEBS Lett 153(1):53-9

 [7] Ryoji M., Yamane T., Gordon M., Kaji A., 1985, Two modes of amber codon read-through in vitro., Arch Biochem Biophys 238(2):636-41

 [8] Shimizu I., Kaji A., 1991, Identification of the promoter region of the ribosome-releasing factor cistron (frr)., J Bacteriol 173(16):5181-7

 [9] Uehara Y., Hori M., Umezawa H., 1976, Specific inhibition of the termination process of protein synthesis by negamycin., Biochim Biophys Acta 442(2):251-62

 [10] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [11] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB