RegulonDB RegulonDB 10.9: Gene Form
   

fruA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fruA psuK fruK psuG TSS_2463 TSS_2463 TSS_2462 TSS_2462 psuGp4 psuGp4

Gene      
Name: fruA    Texpresso search in the literature
Synonym(s): ECK2160, EG10336, b2167, ptsF
Genome position(nucleotides): 2259719 <-- 2261410 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.73
External database links:  
ASAP:
ABE-0007172
CGSC:
350
ECHOBASE:
EB0332
ECOLIHUB:
fruA
OU-MICROARRAY:
b2167
STRING:
511145.b2167
COLOMBOS: fruA


Product      
Name: fructose-specific PTS multiphosphoryl transfer protein FruA
Synonym(s): EIIB'BCfru, EIIBCfru, Enzyme IIB'BCfru, Enzyme IIBCfru, FruA, PtsF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 57.519
Isoelectric point: 9.048
Motif(s):
 
Type Positions Sequence
104 -> 201 KRVVAVTACPTGVAHTFMAAEAIETEAKKRGWWVKVETRGSVGAGNAITPEEVAAADLVIVAADIEVDLAKFAGKPMYRTSTGLALKKTAQELDKAVA
226 -> 561 AYRHLLTGVSYMLPMVVAGGLCIALSFAFGIEAFKEPGTLAAALMQIGGGSAFALMVPVLAGYIAFSIADRPGLTPGLIGGMLAVSTGSGFIGGIIAGFLAGYIAKLISTQLKLPQSMEALKPILIIPLISSLVVGLAMIYLIGKPVAGILEGLTHWLQTMGTANAVLLGAILGGMMCTDMGGPVNKAAYAFGVGLLSTQTYGPMAAIMAAGMVPPLAMGLATMVARRKFDKAQQEGGKAALVLGLCFISEGAIPFAARDPMRVLPCCIVGGALTGAISMAIGAKLMAPHGGLFVLLIPGAITPVLGYLVAIIAGTLVAGLAYAFLKRPEVDAVAK
489 -> 509 VLPCCIVGGALTGAISMAIGA
518 -> 538 LFVLLIPGAITPVLGYLVAII
233 -> 496 GVSYMLPMVVAGGLCIALSFAFGIEAFKEPGTLAAALMQIGGGSAFALMVPVLAGYIAFSIADRPGLTPGLIGGMLAVSTGSGFIGGIIAGFLAGYIAKLISTQLKLPQSMEALKPILIIPLISSLVVGLAMIYLIGKPVAGILEGLTHWLQTMGTANAVLLGAILGGMMCTDMGGPVNKAAYAFGVGLLSTQTYGPMAAIMAAGMVPPLAMGLATMVARRKFDKAQQEGGKAALVLGLCFISEGAIPFAARDPMRVLPCCIVG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
GO:0005351 - carbohydrate:proton symporter activity
GO:0022877 - protein-N(PI)-phosphohistidine-fructose phosphotransferase system transporter activity
GO:0090563 - protein-phosphocysteine-sugar phosphotransferase activity
GO:0090582 - protein-phosphocysteine-D-fructose-phosphotransferase system transporter activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:0015755 - fructose transmembrane transport
GO:0034219 - carbohydrate transmembrane transport
GO:1902600 - proton transmembrane transport
GO:0032445 - fructose import
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
FRUA-MONOMER
ECOLIWIKI:
b2167
INTERPRO:
IPR003352
INTERPRO:
IPR013014
INTERPRO:
IPR013011
INTERPRO:
IPR036095
INTERPRO:
IPR003353
INTERPRO:
IPR003501
INTERPRO:
IPR006327
PFAM:
PF02378
PFAM:
PF02302
PRIDE:
P20966
PRODB:
PRO_000022699
PROSITE:
PS51104
PROSITE:
PS51099
REFSEQ:
NP_416672
SMR:
P20966
UNIPROT:
P20966


Operon      
Name: fruBKA         
Operon arrangement:
Transcription unit        Promoter
fruBKA


Transcriptional Regulation      
Display Regulation             
Repressed by: Cra


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter psuGp4 2258557 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2462 2260442 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2463 2262092 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB