RegulonDB RegulonDB 10.8: Gene Form
   

ftsI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ftsI murE ftsL ftsI-int rsmH murF TSS_160 TSS_160 TSS_159 TSS_159

Gene      
Name: ftsI    Texpresso search in the literature
Synonym(s): ECK0085, EG10341, b0084, pbpB, sep
Genome position(nucleotides): 91413 --> 93179 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.99
External database links:  
ASAP:
ABE-0000309
CGSC:
423
ECHOBASE:
EB0337
OU-MICROARRAY:
b0084
PortEco:
ftsI
STRING:
511145.b0084
COLOMBOS: ftsI


Product      
Name: peptidoglycan DD-transpeptidase FtsI
Synonym(s): FtsI, PBP3, PbpB, Sep, essential cell division protein FtsI, penicillin-binding protein 3
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 63.877
Isoelectric point: 10.101
Motif(s):
 
Type Positions Sequence
23 -> 23 R
61 -> 61 S
70 -> 220 SRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGISVGDRWKALANALNIPLDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLREESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIED
307 -> 307 S
57 -> 57 G

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
  5 - cell processes --> 5.1 - cell division
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
  6 - cell structure --> 6.2 - murein
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0031226 - intrinsic component of plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0032153 - cell division site
molecular_function GO:0005515 - protein binding
GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0004180 - carboxypeptidase activity
GO:0008955 - peptidoglycan glycosyltransferase activity
GO:0009002 - serine-type D-Ala-D-Ala carboxypeptidase activity
GO:0008658 - penicillin binding
biological_process GO:0051301 - cell division
GO:0006508 - proteolysis
GO:0007049 - cell cycle
GO:0009252 - peptidoglycan biosynthetic process
GO:0042493 - response to drug
GO:0043093 - FtsZ-dependent cytokinesis
GO:0000917 - division septum assembly
GO:0008360 - regulation of cell shape
GO:0071555 - cell wall organization
Note(s): Note(s): ...[more].
Reference(s): [1] Barbati S., et al., 2010
[2] Boes A., et al., 2019
[3] Botta GA., et al., 1981
[4] Ishino F., et al., 1981
[5] Jahn LJ., et al., 2017
[6] Soderstrom B., et al., 2019
External database links:  
DIP:
DIP-47950N
ECOCYC:
EG10341-MONOMER
ECOLIWIKI:
b0084
INTERPRO:
IPR037532
INTERPRO:
IPR036138
INTERPRO:
IPR012338
INTERPRO:
IPR005311
INTERPRO:
IPR001460
MINT:
P0AD68
MODBASE:
P0AD68
PDB:
4BJQ
PDB:
4BJP
PFAM:
PF03717
PFAM:
PF00905
PRIDE:
P0AD68
PRODB:
PRO_000022718
REFSEQ:
NP_414626
SMR:
P0AD68
UNIPROT:
P0AD68


Operon      
Name: mraZ-rsmH-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC         
Operon arrangement:
Transcription unit        Promoter
mraZW-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
mraW-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsQ
ftsQAZ
ftsAZ
ftsZ
ftsZ
ftsZ
lpxC
lpxC


Transcriptional Regulation      
Display Regulation             
Repressed by: MraZ, LexA, PdhR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_159 92485 forward nd [RS-EPT-CBR] [7]
  promoter TSS_160 94608 forward nd [RS-EPT-CBR] [7]
  promoter TSS_161 (cluster) 94681 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Barbati S., Grenga L., Luzi G., Paolozzi L., Ghelardini P., 2010, Prokaryotic division interactome: setup of an assay for protein-protein interaction mutant selection., Res Microbiol 161(2):118-26

 [2] Boes A., Olatunji S., Breukink E., Terrak M., 2019, Regulation of the Peptidoglycan Polymerase Activity of PBP1b by Antagonist Actions of the Core Divisome Proteins FtsBLQ and FtsN., MBio 10(1)

 [3] Botta GA., Park JT., 1981, Evidence for involvement of penicillin-binding protein 3 in murein synthesis during septation but not during cell elongation., J Bacteriol 145(1):333-40

 [4] Ishino F., Matsuhashi M., 1981, Peptidoglycan synthetic enzyme activities of highly purified penicillin-binding protein 3 in Escherichia coli: a septum-forming reaction sequence., Biochem Biophys Res Commun 101(3):905-11

 [5] Jahn LJ., Munck C., Ellabaan MMH., Sommer MOA., 2017, Adaptive Laboratory Evolution of Antibiotic Resistance Using Different Selection Regimes Lead to Similar Phenotypes and Genotypes., Front Microbiol 8:816

 [6] Soderstrom B., Chan H., Daley DO., 2019, Super-resolution images of peptidoglycan remodelling enzymes at the division site of Escherichia coli., Curr Genet 65(1):99-101

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB