RegulonDB RegulonDB 10.6.3: Gene Form
   

ftsQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ftsA ftsZ ddlB ftsQ murC RcsB SdiA SdiA SdiA DicF ppGpp ppGpp ppGpp TSS_192 TSS_192 TSS_191 TSS_191 TSS_190 TSS_190 TSS_189 (cluster) TSS_189 (cluster) TSS_188 TSS_188 TSS_187 TSS_187 TSS_186 TSS_186 ftsZp2 ftsZp2 ftsZp3 ftsZp3 ftsZp4 ftsZp4 TSS_185 TSS_185 TSS_184 TSS_184 TSS_183 TSS_183 TSS_182 TSS_182 TSS_181 TSS_181 ftsAp1 ftsAp1 TSS_180 TSS_180 TSS_179 (cluster) TSS_179 (cluster) TSS_178 TSS_178 TSS_177 TSS_177 TSS_176 TSS_176 ftsQp1 ftsQp1 TSS_175 TSS_175 ftsQp2 ftsQp2 TSS_174 TSS_174

Gene      
Name: ftsQ    Texpresso search in the literature
Synonym(s): ECK0094, EG10342, b0093
Genome position(nucleotides): 103155 --> 103985 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.31
External database links:  
ASAP:
ABE-0000329
CGSC:
734
ECHOBASE:
EB0338
ECOCYC:
EG10342
ECOLIHUB:
ftsQ
OU-MICROARRAY:
b0093
REGULONDB:
b0093
STRING:
511145.b0093
M3D: ftsQ
COLOMBOS: ftsQ
PortEco: b0093


Product      
Name: cell division protein FtsQ
Synonym(s): FtsQ, essential cell division protein FtsQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 31.434
Isoelectric point: 6.825
Motif(s):
 
Type Positions Sequence
38 -> 38 V
113 -> 113 K
32 -> 32 L
125 -> 125 E
56 -> 126 PLSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLPWIKQVSVRKQWPDELKIHLVEY

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0032153 - cell division site
GO:0032155 - cell division site part
molecular_function GO:0005515 - protein binding
GO:0042802 - identical protein binding
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0043093 - FtsZ-dependent cytokinesis
GO:0000917 - division septum assembly
GO:0090529 - cell septum assembly
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Begg KJ., et al., 1980
External database links:  
DIP:
DIP-9706N
ECOCYC:
EG10342-MONOMER
ECOLIWIKI:
b0093
INTERPRO:
IPR026579
INTERPRO:
IPR034746
INTERPRO:
IPR013685
INTERPRO:
IPR005548
MINT:
P06136
PANTHER:
PTHR35851
PDB:
4V6M
PDB:
4UE4
PDB:
2VH1
PDB:
6H9N
PDB:
6H9O
PFAM:
PF08478
PFAM:
PF03799
PRIDE:
P06136
PRODB:
PRO_000022722
PROSITE:
PS51779
PROTEINMODELPORTAL:
P06136
REFSEQ:
NP_414635
SMR:
P06136
UNIPROT:
P06136


Operon      
Name: mraZ-rsmH-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC         
Operon arrangement:
Transcription unit        Promoter
mraZW-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
mraW-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsQ
ftsQAZ
ftsAZ
ftsZ
ftsZ
ftsZ
null
null


Transcriptional Regulation      
Display Regulation             
Activated by: SdiA
Repressed by: MraZ, LexA, SdiA, PdhR
Growth Conditions:

[1] 

C: Escherichia coli| LB medium| 28.0 C
E: Escherichia coli| rpoS knockout mutant| LB medium| 28.0 C

[2] 

C: Escherichia coli| conditioned culture medium| tryptone 10 g/L; yeast extract 5 g/L| 37.0 C| mid to late exponential phase
E: Escherichia coli| sdiA knockout mutant| conditioned culture medium| tryptone 10 g/L; yeast extract 5 g/L| 37.0 C| mid to late exponential phase

[3] 

C: Escherichia coli| rpoS knockout mutant| LB medium| 28.0 C
E: Escherichia coli| rpoS knockout mutant| LE392 conditioned medium| 28.0 C

[4] 

C: Escherichia coli| sdiA knockout mutant; plasmid pGB2 mutant| LB medium| 28.0 C| OD600 of 0.65
E: Escherichia coli| sdiA knockout mutant; plasmid pCX16 (sdiA) mutant| LB medium| 28.0 C| OD600 of 0.65

[5] 

C: Escherichia coli| LB medium| 28.0 C| OD600 of 0.4
E: Escherichia coli| LB medium; conditioned culture medium| 28.0 C| OD600 of 0.4

[6] 

C: Escherichia coli| LB medium| 37.0 C| mid to late exponential phase
E: Escherichia coli| conditioned culture medium| 37.0 C| mid to late exponential phase

[7] 

C: Escherichia coli| LB medium| 37.0 C| mid to late exponential phase
E: Escherichia coli| sdiA knockout mutant| LB medium| 37.0 C| mid to late exponential phase

[8] 

C: Escherichia coli| sdiA knockout mutant; plasmid pCX16 (sdiA) mutant| LB medium| 28.0 C| OD600 of 0.65
E: Escherichia coli| sdiA knockout mutant; plasmid pCX16 (sdiA) mutant| LB medium| N-Decanoyl-DL-homoserine lactone 1 µM| 28.0 C| OD600 of 0.65

[9] 

C: Escherichia coli| LB medium| 28.0 C| mid exponential phase
E: Escherichia coli| LB medium| 28.0 C| stationary phase

[10] 

C: Escherichia coli| sdiA knockout mutant; plasmid pCX16 (sdiA) mutant| LB medium| 28.0 C| OD600 of 0.65
E: Escherichia coli| sdiA knockout mutant; plasmid pCX16 (sdiA) mutant| LB medium| V. harveyi autoinducer 1 µM| 28.0 C| OD600 of 0.65

[11] 

C: Escherichia coli| sdiA knockout mutant; plasmid pCX16 (sdiA) mutant| LB medium| 28.0 C| OD600 of 0.65
E: Escherichia coli| sdiA knockout mutant; plasmid pCX16 (sdiA) mutant| LB medium| N-(3-oxohexanoyl)-L-homoserine lactone 1 µM| 28.0 C| OD600 of 0.65



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_174 102679 forward nd [RS-EPT-CBR] [2]
  promoter TSS_175 102865 forward nd [RS-EPT-CBR] [2]
  promoter TSS_176 102872 forward nd [RS-EPT-CBR] [2]
  promoter TSS_177 103019 forward nd [RS-EPT-CBR] [2]
  promoter TSS_178 103024 forward nd [RS-EPT-CBR] [2]
  promoter TSS_179 (cluster) 103028 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_180 103133 forward nd [RS-EPT-CBR] [2]
  promoter TSS_181 103608 forward nd [RS-EPT-CBR] [2]
  promoter TSS_182 103889 forward nd [RS-EPT-CBR] [2]
  promoter TSS_183 103960 forward nd [RS-EPT-CBR] [2]
  promoter TSS_184 104188 forward nd [RS-EPT-CBR] [2]
  promoter TSS_185 104305 forward nd [RS-EPT-CBR] [2]
  promoter TSS_186 105087 forward nd [RS-EPT-CBR] [2]
  promoter TSS_187 105093 forward nd [RS-EPT-CBR] [2]
  promoter TSS_188 105291 forward nd [RS-EPT-CBR] [2]
  promoter TSS_189 (cluster) 105669 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_190 105677 forward nd [RS-EPT-CBR] [2]
  promoter TSS_191 105795 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_192 105816 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Begg KJ., Hatfull GF., Donachie WD., 1980, Identification of new genes in a cell envelope-cell division gene cluster of Escherichia coli: cell division gene ftsQ., J Bacteriol 144(1):435-7

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB