RegulonDB RegulonDB 10.6.3: Gene Form
   

ftsZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ftsA ftsZ lpxC ftsQ DicF ppGpp ppGpp TSS_194 TSS_194 lpxCp2 lpxCp2 lpxCp1 lpxCp1 TSS_192 TSS_192 TSS_191 TSS_191 TSS_190 TSS_190 TSS_189 (cluster) TSS_189 (cluster) TSS_188 TSS_188 TSS_187 TSS_187 TSS_186 TSS_186 ftsZp2 ftsZp2 ftsZp3 ftsZp3 ftsZp4 ftsZp4 TSS_185 TSS_185 TSS_184 TSS_184

Gene      
Name: ftsZ    Texpresso search in the literature
Synonym(s): ECK0096, EG10347, b0095, sfiB, sulB
Genome position(nucleotides): 105305 --> 106456 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.17
External database links:  
ASAP:
ABE-0000333
CGSC:
143
ECHOBASE:
EB0343
ECOCYC:
EG10347
ECOLIHUB:
ftsZ
OU-MICROARRAY:
b0095
REGULONDB:
b0095
STRING:
511145.b0095
M3D: ftsZ
COLOMBOS: ftsZ
PortEco: b0095


Product      
Name: cell division protein FtsZ
Synonym(s): FtsZ, SfiB, SulB, essential cell division protein FtsZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 40.324
Isoelectric point: 4.38
Motif(s):
 
Type Positions Sequence
1 -> 32 MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRE
317 -> 383 MDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD
107 -> 109 GTG
32 -> 39 ERIEGVEF
33 -> 49 RIEGVEFFAVNTDAQAL

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0032153 - cell division site
molecular_function GO:0005515 - protein binding
GO:0000166 - nucleotide binding
GO:0003924 - GTPase activity
GO:0005525 - GTP binding
GO:0042802 - identical protein binding
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0043093 - FtsZ-dependent cytokinesis
GO:0000917 - division septum assembly
GO:0051258 - protein polymerization
GO:0090529 - cell septum assembly
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Dai K., et al., 1991
External database links:  
DIP:
DIP-31873N
ECOCYC:
EG10347-MONOMER
ECOLIWIKI:
b0095
INTERPRO:
IPR036525
INTERPRO:
IPR024757
INTERPRO:
IPR020805
INTERPRO:
IPR018316
INTERPRO:
IPR008280
INTERPRO:
IPR003008
INTERPRO:
IPR000158
MINT:
P0A9A6
MODBASE:
P0A9A6
PDB:
5KOA
PDB:
5HBU
PDB:
5K58
PDB:
1F47
PDB:
5HSZ
PDB:
5HAW
PFAM:
PF12327
PFAM:
PF00091
PRIDE:
P0A9A6
PRINTS:
PR00423
PRODB:
PRO_000022726
PROSITE:
PS01135
PROSITE:
PS01134
PROTEINMODELPORTAL:
P0A9A6
REFSEQ:
NP_414637
SMART:
SM00864
SMART:
SM00865
SMR:
P0A9A6
SWISSMODEL:
P0A9A6
UNIPROT:
P0A9A6


Operon      
Name: mraZ-rsmH-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC         
Operon arrangement:
Transcription unit        Promoter
mraZW-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
mraW-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsQ
ftsQAZ
ftsAZ
ftsZ
ftsZ
ftsZ
null
null


Transcriptional Regulation      
Display Regulation             
Activated by: RcsB
Repressed by: MraZ, LexA, SdiA, PdhR
Growth Conditions:

[1] 

C: Escherichia coli| LB medium| glucose 10 mM; thiamine 5 µg/mL| 37.0 C| exponential phase
E: Escherichia coli| LB medium| glucose 10 mM; thiamine 5 µg/mL| 37.0 C| stationary phase



Regulation by small RNA    
  Display Regulation
small RNA dicF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_184 104188 forward nd [RS-EPT-CBR] [2]
  promoter TSS_185 104305 forward nd [RS-EPT-CBR] [2]
  promoter TSS_186 105087 forward nd [RS-EPT-CBR] [2]
  promoter TSS_187 105093 forward nd [RS-EPT-CBR] [2]
  promoter TSS_188 105291 forward nd [RS-EPT-CBR] [2]
  promoter TSS_189 (cluster) 105669 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_190 105677 forward nd [RS-EPT-CBR] [2]
  promoter TSS_191 105795 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_192 105816 forward nd [RS-EPT-CBR] [2]
  promoter TSS_194 106940 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Dai K., Lutkenhaus J., 1991, ftsZ is an essential cell division gene in Escherichia coli., J Bacteriol 173(11):3500-6

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB