RegulonDB RegulonDB 10.8: Gene Form
   

fucI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fucI fucK fucP terminator fucUp fucUp

Gene      
Name: fucI    Texpresso search in the literature
Synonym(s): ECK2797, EG10349, b2802
Genome position(nucleotides): 2935584 --> 2937359 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.5
External database links:  
ASAP:
ABE-0009189
CGSC:
10878
ECHOBASE:
EB0345
OU-MICROARRAY:
b2802
PortEco:
fucI
STRING:
511145.b2802
COLOMBOS: fucI


Product      
Name: L-fucose isomerase
Synonym(s): FucI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 64.977
Isoelectric point: 5.741
Motif(s):
 
Type Positions Sequence
7 -> 174 PKIGIRPVIDGRRMGVRESLEEQTMNMAKATAALLTEKLRHACGAAVECVISDTCIAGMAEAAACEEKFSSQNVGLTITVTPCWCYGSETIDMDPTRPKAIWGFNGTERPGAVYLAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFARAGLAVASMKG
390 -> 554 LINSGSAALDGSCKQRDSEGNPTMKPHWEISQQEADACLAATEWCPAIHEYFRGGGYSSRFLTEGGVPFTMTRVNIIKGLGPVLQIAEGWSVELPKDVHDILNKRTNSTWPTTWFAPRLTGKGPFTDVYSVMANWGANHGVLTIGHVGADFITLASMLRIPVCMH
8 -> 8 K
175 -> 354 KSYLSLGGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFRYGEDENNKQYQRNAEQSRAVLRESLLMAMCIRDMMQGNSKLADIGRVEESLGYNAIAAGFQGQRHWTDQYPNGDTAEAILNSSFDWNGVREPFVVATENDSLNGVAMLMGHQLTG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016853 - isomerase activity
GO:0046872 - metal ion binding
GO:0016861 - intramolecular oxidoreductase activity, interconverting aldoses and ketoses
GO:0008736 - L-fucose isomerase activity
GO:0008790 - arabinose isomerase activity
GO:0030145 - manganese ion binding
GO:0042802 - identical protein binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0005996 - monosaccharide metabolic process
GO:0006004 - fucose metabolic process
GO:0019317 - fucose catabolic process
GO:0019571 - D-arabinose catabolic process
GO:0042355 - L-fucose catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
FUCISOM-MONOMER
ECOLIWIKI:
b2802
INTERPRO:
IPR038393
INTERPRO:
IPR005763
INTERPRO:
IPR038391
INTERPRO:
IPR004216
INTERPRO:
IPR038392
INTERPRO:
IPR009015
INTERPRO:
IPR012888
INTERPRO:
IPR012889
INTERPRO:
IPR015888
MODBASE:
P69922
PDB:
1FUI
PFAM:
PF02952
PFAM:
PF07882
PFAM:
PF07881
PRIDE:
P69922
PRODB:
PRO_000022728
REFSEQ:
NP_417282
SMR:
P69922
UNIPROT:
P69922


Operon      
Name: fucPIKUR         
Operon arrangement:
Transcription unit        Promoter
fucPIKUR
fucU
fucR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FucR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB