RegulonDB RegulonDB 10.8: Gene Form
   

fucK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fucI fucK fucU terminator fucUp fucUp

Gene      
Name: fucK    Texpresso search in the literature
Synonym(s): ECK2798, EG10350, b2803
Genome position(nucleotides): 2937468 --> 2938886 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.09
External database links:  
ASAP:
ABE-0009191
CGSC:
10881
ECHOBASE:
EB0346
OU-MICROARRAY:
b2803
PortEco:
fucK
STRING:
511145.b2803
COLOMBOS: fucK


Product      
Name: L-fuculokinase
Synonym(s): FucK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 52.259
Isoelectric point: 5.283
Motif(s):
 
Type Positions Sequence
259 -> 438 LSSGTWEILMVRSAQVDTSLLSQYAGSTCELDSQAGLYNPGMQWLASGVLEWVRKLFWTAETPWQMLIEEARLIAPGADGVKMQCDLLSCQNAGWQGVTLNTTRGHFYRAALEGLTAQLQRNLQMLEKIGHFKASELLLVGGGSRNTLWNQIKANMLDIPVKVLDDAETTVAGAALFGWY
5 -> 249 VILVLDCGATNVRAIAVNRQGKIVARASTPNASDIAMENNTWHQWSLDAILQRFADCCRQINSELTECHIRGIAVTTFGVDGALVDKQGNLLYPIISWKCPRTAAVMDNIERLISAQRLQAISGVGAFSFNTLYKLVWLKENHPQLLERAHAWLFISSLINHRLTGEFTTDITMAGTSQMLDIQQRDFSPQILQATGIPRRLFPRLVEAGEQIGTLQNSAAAMLGLPVGIPVISAGHDTQFALFG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0016773 - phosphotransferase activity, alcohol group as acceptor
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008737 - L-fuculokinase activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0019301 - rhamnose catabolic process
GO:0016310 - phosphorylation
GO:0006004 - fucose metabolic process
GO:0019317 - fucose catabolic process
GO:0019571 - D-arabinose catabolic process
GO:0042355 - L-fucose catabolic process
GO:0046835 - carbohydrate phosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Chen YM., et al., 1984
[2] Chen YM., et al., 1987
[3] Schrader JM., et al., 2014
External database links:  
DIP:
DIP-9712N
ECOCYC:
FUCULOKIN-MONOMER
ECOLIWIKI:
b2803
INTERPRO:
IPR000577
INTERPRO:
IPR018485
INTERPRO:
IPR018484
INTERPRO:
IPR018483
INTERPRO:
IPR013450
MINT:
MINT-1305054
MODBASE:
P11553
PANTHER:
PTHR10196:SF60
PFAM:
PF02782
PFAM:
PF00370
PRIDE:
P11553
PRODB:
PRO_000022729
PROSITE:
PS00445
PROSITE:
PS00933
REFSEQ:
NP_417283
SMR:
P11553
UNIPROT:
P11553


Operon      
Name: fucPIKUR         
Operon arrangement:
Transcription unit        Promoter
fucPIKUR
fucU
fucR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FucR


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Chen YM., Chakrabarti T., Lin EC., 1984, Constitutive activation of L-fucose genes by an unlinked mutation in Escherichia coli., J Bacteriol 159(2):725-9

 [2] Chen YM., Zhu Y., Lin EC., 1987, The organization of the fuc regulon specifying L-fucose dissimilation in Escherichia coli K12 as determined by gene cloning., Mol Gen Genet 210(2):331-7

 [3] Schrader JM., Zhou B., Li GW., Lasker K., Childers WS., Williams B., Long T., Crosson S., McAdams HH., Weissman JS., Shapiro L., 2014, The coding and noncoding architecture of the Caulobacter crescentus genome., PLoS Genet 10(7):e1004463


RegulonDB