RegulonDB RegulonDB 10.6.3: Gene Form
   

fucR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rlmM fucR fucU ygdD terminator TSS_3116 TSS_3116

Gene      
Name: fucR    Texpresso search in the literature
Synonym(s): ECK2800, EG10353, b2805
Genome position(nucleotides): 2939368 --> 2940099 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.22
External database links:  
ASAP:
ABE-0009195
CGSC:
10884
ECHOBASE:
EB0349
ECOCYC:
EG10353
ECOLIHUB:
fucR
OU-MICROARRAY:
b2805
REGULONDB:
b2805
STRING:
511145.b2805
M3D: fucR
COLOMBOS: fucR
PortEco: b2805


Product      
Name: DNA-binding transcriptional activator FucR
Synonym(s): FucR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: DeoR
Cellular location: cytosol
Molecular weight: 27.362
Isoelectric point: 8.024
Motif(s):
 
Type Positions Sequence
5 -> 60 RQQAIVDLLLNHTSLTTEALSEQLKVSKETIRRDLNELQTQGKILRNHGRAKYIHR
76 -> 233 HYAHKADIAREALAWIEEGMVIALDASSTCWYLARQLPDINIQVFTNSHPICHELGKRERIQLISSGGTLERKYGCYVNPSLISQLKSLEIDLFIFSCEGIDSSGALWDSNAINADYKSMLLKRAAQSLLLIDKSKFNRSGEARIGHLDEVTHIISDE
1 -> 57 MKAARQQAIVDLLLNHTSLTTEALSEQLKVSKETIRRDLNELQTQGKILRNHGRAKY
19 -> 38 LTTEALSEQLKVSKETIRRD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0098531 - ligand-activated transcription factor activity
GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006355 - regulation of transcription, DNA-templated
GO:0006004 - fucose metabolic process
GO:0043468 - regulation of fucose catabolic process
Reference(s): [1] Chen YM., et al., 1987
[2] Lu Z., et al., 1989
External database links:  
ECOCYC:
PD00444
ECOLIWIKI:
b2805
INTERPRO:
IPR001034
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR018356
INTERPRO:
IPR037171
INTERPRO:
IPR014036
MODBASE:
P0ACK8
PFAM:
PF00455
PFAM:
PF08220
PRIDE:
P0ACK8
PRINTS:
PR00037
PRODB:
PRO_000022732
PROSITE:
PS00894
PROSITE:
PS51000
PROTEINMODELPORTAL:
P0ACK8
REFSEQ:
NP_417285
SMART:
SM00420
SMR:
P0ACK8
UNIPROT:
P0ACK8


Operon      
Name: fucPIKUR         
Operon arrangement:
Transcription unit        Promoter
fucPIKUR
fucR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FucR


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3116 2941109 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Chen YM., Zhu Y., Lin EC., 1987, The organization of the fuc regulon specifying L-fucose dissimilation in Escherichia coli K12 as determined by gene cloning., Mol Gen Genet 210(2):331-7

 [2] Lu Z., Lin EC., 1989, The nucleotide sequence of Escherichia coli genes for L-fucose dissimilation., Nucleic Acids Res 17(12):4883-4

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB