RegulonDB RegulonDB 10.6.3: Gene Form
   

fucU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fucK fucR fucU terminator

Gene      
Name: fucU    Texpresso search in the literature
Synonym(s): ECK2799, EG10355, b2804
Genome position(nucleotides): 2938888 --> 2939310 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.94
External database links:  
ASAP:
ABE-0009193
ECHOBASE:
EB0350
ECOCYC:
EG10355
ECOLIHUB:
fucU
OU-MICROARRAY:
b2804
REGULONDB:
b2804
STRING:
511145.b2804
M3D: fucU
COLOMBOS: fucU
PortEco: b2804


Product      
Name: L-fucose mutarotase
Synonym(s): FucU
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.473
Isoelectric point: 5.664
Motif(s):
 
Type Positions Sequence
4 -> 139 TISPLISPELLKVLAEMGHGDEIIFSDAHFPAHSMGPQVIRADGLLVSDLLQAIIPLFELDSYAPPLVMMAAVEGDTLDPEVERRYRNALSLQAPCPDIIRINRFAFYERAQKAFAIVITGERAKYGNILLKKGVT
106 -> 140 NRFAFYERAQKAFAIVITGERAKYGNILLKKGVTP
129 -> 131 YGN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0036373 - L-fucose mutarotase activity
GO:0016853 - isomerase activity
GO:0016854 - racemase and epimerase activity
GO:0016857 - racemase and epimerase activity, acting on carbohydrates and derivatives
GO:0048029 - monosaccharide binding
GO:0042806 - fucose binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0005996 - monosaccharide metabolic process
GO:0006004 - fucose metabolic process
GO:0042354 - L-fucose metabolic process
GO:0036065 - fucosylation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47990N
ECOCYC:
EG10355-MONOMER
ECOLIWIKI:
b2804
INTERPRO:
IPR007721
INTERPRO:
IPR023751
INTERPRO:
IPR023750
MINT:
MINT-1243432
MODBASE:
P0AEN8
PDB:
2WCV
PFAM:
PF05025
PRIDE:
P0AEN8
PRODB:
PRO_000022733
PROTEINMODELPORTAL:
P0AEN8
REFSEQ:
NP_417284
SMR:
P0AEN8
UNIPROT:
P0AEN8


Operon      
Name: fucPIKUR         
Operon arrangement:
Transcription unit        Promoter
fucPIKUR
fucR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FucR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB