RegulonDB RegulonDB 10.8: Gene Form
   

fumA gene in Escherichia coli K-12 genome

Gene      
Name: fumA    Texpresso search in the literature
Synonym(s): ECK1607, EG10356, b1612
Genome position(nucleotides): 1686731 <-- 1688377 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.55
External database links:  
ASAP:
ABE-0005392
CGSC:
18292
ECHOBASE:
EB0351
OU-MICROARRAY:
b1612
PortEco:
fumA
STRING:
511145.b1612
COLOMBOS: fumA


Product      
Name: fumarase A
Synonym(s): FumA
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 60.299
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
51 -> 326 ARQAFHDASFMLRPAHQQQVADILRDPEASENDKYVALQFLRNSDIAAKGVLPTCQDTGTAIIVGKKGQRVWTGGGDEAALARGVYNTYIEDNLRYSQNAPLDMYKEVNTGTNLPAQIDLYAVDGDEYKFLCIAKGGGSANKTYLYQETKALLTPGKLKNYLVEKMRTLGTAACPPYHIAFVIGGTSAETNLKTVKLASAKYYDELPTEGNEHGQAFRDVELEKELLIEAQNLGLGAQFGGKYFAHDIRVIRLPRHGASCPVGMGVSCSADRNIKA
2 -> 548 SNKPFHYQAPFPLKKDDTEYYLLTSEHVSVSEFEGQEILKVAPEALTLLARQAFHDASFMLRPAHQQQVADILRDPEASENDKYVALQFLRNSDIAAKGVLPTCQDTGTAIIVGKKGQRVWTGGGDEAALARGVYNTYIEDNLRYSQNAPLDMYKEVNTGTNLPAQIDLYAVDGDEYKFLCIAKGGGSANKTYLYQETKALLTPGKLKNYLVEKMRTLGTAACPPYHIAFVIGGTSAETNLKTVKLASAKYYDELPTEGNEHGQAFRDVELEKELLIEAQNLGLGAQFGGKYFAHDIRVIRLPRHGASCPVGMGVSCSADRNIKAKINRQGIWIEKLEHNPGKYIPEELRKAGEGEAVRVDLNRPMKEILAQLSQYPVSTRLSLNGTIIVGRDIAHAKLKERMDNGEGLPQYIKDHPIYYAGPAKTPEGYASGSLGPTTAGRMDSYVDQLQAQGGSMIMLAKGNRSQQVTDACKKHGGFYLGSIGGPAAVLAQGSIKSLECVEYPELGMEAIWKIEVEDFPAFILVDDKGNDFFQQIQLTQCTRCVK
332 -> 537 GIWIEKLEHNPGKYIPEELRKAGEGEAVRVDLNRPMKEILAQLSQYPVSTRLSLNGTIIVGRDIAHAKLKERMDNGEGLPQYIKDHPIYYAGPAKTPEGYASGSLGPTTAGRMDSYVDQLQAQGGSMIMLAKGNRSQQVTDACKKHGGFYLGSIGGPAAVLAQGSIKSLECVEYPELGMEAIWKIEVEDFPAFILVDDKGNDFFQQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.4 - TCA cycle
Gene Ontology Terms (GO)  
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0016853 - isomerase activity
GO:0046872 - metal ion binding
GO:0016836 - hydro-lyase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0004333 - fumarate hydratase activity
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
GO:0050163 - oxaloacetate tautomerase activity
biological_process GO:0006091 - generation of precursor metabolites and energy
GO:0006099 - tricarboxylic acid cycle
Note(s): Note(s): ...[more].
Reference(s): [1] Calderon IL., et al., 2009
[2] Gray CT., et al., 1966
External database links:  
DIP:
DIP-36200N
ECOCYC:
FUMA-MONOMER
ECOLIWIKI:
b1612
INTERPRO:
IPR004647
INTERPRO:
IPR036660
INTERPRO:
IPR020557
INTERPRO:
IPR004646
INTERPRO:
IPR011167
MINT:
MINT-1310290
PFAM:
PF05681
PFAM:
PF05683
PRIDE:
P0AC33
PRODB:
PRO_000022734
PROSITE:
PS00163
REFSEQ:
NP_416129
SMR:
P0AC33
UNIPROT:
P0AC33


Operon      
Name: fumAC         
Operon arrangement:
Transcription unit        Promoter
fumC
fumC
fumA
fumAC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: FNR, ArcA


Regulation by small RNA    
  Display Regulation
small RNA ryhB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1895 1688441 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Calderon IL., Elias AO., Fuentes EL., Pradenas GA., Castro ME., Arenas FA., Perez JM., Vasquez CC., 2009, Tellurite-mediated disabling of [4Fe-4S] clusters of Escherichia coli dehydratases., Microbiology 155(Pt 6):1840-6

 [2] Gray CT., Wimpenny JW., Mossman MR., 1966, Regulation of metabolism in facultative bacteria. II. Effects of aerobiosis, anaerobiosis and nutrition on the formation of Krebs cycle enzymes in Escherichia coli., Biochim Biophys Acta 117(1):33-41

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB