RegulonDB RegulonDB 10.8: Gene Form
   

fumC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fumA fumC rstB tus CRP CRP CRP MarA SoxS Rob terminator fumCp fumCp fumCp1 fumCp1 tusp2 tusp2

Gene      
Name: fumC    Texpresso search in the literature
Synonym(s): ECK1606, EG10358, b1611
Genome position(nucleotides): 1685185 <-- 1686588 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.77
External database links:  
ASAP:
ABE-0005380
CGSC:
15273
ECHOBASE:
EB0353
MIM:
150800
MIM:
606812
MIM:
136850
OU-MICROARRAY:
b1611
PortEco:
fumC
STRING:
511145.b1611
COLOMBOS: fumC


Product      
Name: fumarase C
Synonym(s): FumC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 50.489
Isoelectric point: 6.561
Motif(s):
 
Type Positions Sequence
12 -> 342 GAIDVPADKLWGAQTQRSLEHFRISTEKMPTSLIHALALTKRAAAKVNEDLGLLSEEKASAIRQAADEVLAGQHDDEFPLAIWQTGSGTQSNMNMNEVLANRASELLGGVRGMERKVHPNDDVNKSQSSNDVFPTAMHVAALLALRKQLIPQLKTLTQTLNEKSRAFADIVKIGRTHLQDATPLTLGQEISGWVAMLEHNLKHIEYSLPHVAELALGGTAVGTGLNTHPEYARRVADELAVITCAPFVTAPNKFEALATCDALVQAHGALKGLAASLMKIANDVRWLASGPRCGIGEISIPENEPGSSIMPGKVNPTQCEALTMLCCQVMG
188 -> 188 H
127 -> 127 K
408 -> 461 LVTALNTHIGYDKAAEIAKKAHKEGLTLKAAALALGYLSEAEFDSWVRPEQMVG
98 -> 100 SGT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.4 - TCA cycle
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0045239 - tricarboxylic acid cycle enzyme complex
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0004333 - fumarate hydratase activity
GO:0042802 - identical protein binding
biological_process GO:0008152 - metabolic process
GO:0006099 - tricarboxylic acid cycle
GO:0006979 - response to oxidative stress
GO:0006108 - malate metabolic process
GO:0006106 - fumarate metabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Calderon IL., et al., 2009
[2] Chen YP., et al., 2012
[3] Guest JR., et al., 1985
[4] Woods SA., et al., 1986
External database links:  
DIP:
DIP-9719N
ECOCYC:
FUMC-MONOMER
ECOLIWIKI:
b1611
INTERPRO:
IPR022761
INTERPRO:
IPR024083
INTERPRO:
IPR020557
INTERPRO:
IPR018951
INTERPRO:
IPR008948
INTERPRO:
IPR005677
INTERPRO:
IPR000362
MODBASE:
P05042
PANTHER:
PTHR11444
PDB:
6NZA
PDB:
6NZ9
PDB:
6NZC
PDB:
2FUS
PDB:
6NZB
PDB:
1FUO
PDB:
1FUP
PDB:
1FUQ
PDB:
1FUR
PDB:
1KQ7
PDB:
1YFE
PFAM:
PF00206
PFAM:
PF10415
PRIDE:
P05042
PRINTS:
PR00149
PRODB:
PRO_000022736
PROSITE:
PS00163
REFSEQ:
NP_416128
SMR:
P05042
UNIPROT:
P05042


Operon      
Name: fumAC         
Operon arrangement:
Transcription unit        Promoter
fumC
fumC
fumA
fumAC


Transcriptional Regulation      
Display Regulation             
Activated by: SoxR, CRP, MarA, SoxS, Rob
Repressed by: FNR, Fur, ArcA
Undetermined regulation CRP
Growth Conditions:

[1] 

C: Escherichia coli| soxR knockout mutant; soxS knockout mutant| LB medium| 37.0 C
E: Escherichia coli| soxR knockout mutant; soxS knockout mutant; plasmid pSXR (not induced soxR) mutant| LB medium| 37.0 C

[2] 

C: Escherichia coli| soxR knockout mutant; soxS knockout mutant| LB medium| 37.0 C
E: Escherichia coli| soxR knockout mutant; soxS knockout mutant; plasmid pSXR (IPTG-induced soxR) mutant| LB medium| 37.0 C



RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter tusp2 1684173 forward Similarity to the consensus
Read more >
[ICWHO] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Calderon IL., Elias AO., Fuentes EL., Pradenas GA., Castro ME., Arenas FA., Perez JM., Vasquez CC., 2009, Tellurite-mediated disabling of [4Fe-4S] clusters of Escherichia coli dehydratases., Microbiology 155(Pt 6):1840-6

 [2] Chen YP., Lin HH., Yang CD., Huang SH., Tseng CP., 2012, Regulatory role of cAMP receptor protein over Escherichia coli fumarase genes., J Microbiol 50(3):426-33

 [3] Guest JR., Miles JS., Roberts RE., Woods SA., 1985, The fumarase genes of Escherichia coli: location of the fumB gene and discovery of a new gene (fumC)., J Gen Microbiol 131(11):2971-84

 [4] Woods SA., Miles JS., Roberts RE., Guest JR., 1986, Structural and functional relationships between fumarase and aspartase. Nucleotide sequences of the fumarase (fumC) and aspartase (aspA) genes of Escherichia coli K12., Biochem J 237(2):547-57

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB