RegulonDB RegulonDB 10.7: Gene Form
   

fur gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fldA fur chiQ uof OxyR SoxS OxyR CRP Fur Fur TSS_821 TSS_821 uofp uofp TSS_820 TSS_820 furpb furpb furpa furpa TSS_817 TSS_817 TSS_816 TSS_816 TSS_815 TSS_815 TSS_814 TSS_814 TSS_813 TSS_813

Gene      
Name: fur    Texpresso search in the literature
Synonym(s): ECK0671, EG10359, b0683
Genome position(nucleotides): 710200 <-- 710646 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.87
External database links:  
ASAP:
ABE-0002327
CGSC:
18286
ECHOBASE:
EB0354
OU-MICROARRAY:
b0683
PORTECO:
fur
REGULONDB:
b0683
STRING:
511145.b0683
M3D: fur
COLOMBOS: fur
PortEco: b0683


Product      
Name: DNA-binding transcriptional dual regulator Fur
Synonym(s): Fur
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 16.795
Isoelectric point: 6.059
Motif(s):
 
Type Positions Sequence
2 -> 84 TDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQ
85 -> 148 QHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK
10 -> 130 KAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLY
86 -> 90 HHHDH

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.2 - regulon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0046872 - metal ion binding
GO:0003700 - DNA-binding transcription factor activity
GO:0008270 - zinc ion binding
GO:0043565 - sequence-specific DNA binding
GO:0044212 - transcription regulatory region DNA binding
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0001217 - DNA-binding transcription repressor activity
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:1900376 - regulation of secondary metabolite biosynthetic process
GO:1900705 - negative regulation of siderophore biosynthetic process
GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
Reference(s): [1] Bagg A., et al., 1987
[2] Coy M., et al., 1991
[3] Hantke K. 1981
[4] Saito T., et al., 1991
[5] Schaffer S., et al., 1985
External database links:  
DIP:
DIP-31858N
ECOCYC:
PD00260
ECOLIWIKI:
b0683
INTERPRO:
IPR036388
INTERPRO:
IPR036390
INTERPRO:
IPR002481
MINT:
MINT-1312814
MODBASE:
P0A9A9
PANTHER:
PTHR33202
PDB:
2FU4
PFAM:
PF01475
PRIDE:
P0A9A9
PRODB:
PRO_000022737
PROTEINMODELPORTAL:
P0A9A9
REFSEQ:
NP_415209
SMR:
P0A9A9
SWISSMODEL:
P0A9A9
UNIPROT:
P0A9A9


Operon      
Name: fldA-uof-fur         
Operon arrangement:
Transcription unit        Promoter
fur
fur
uof-fur
fldA-uof-fur


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, OxyR, SoxS
Repressed by: Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_813 710473 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_814 710482 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_815 710700 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_816 710711 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_817 710713 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_820 710828 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_821 711001 reverse nd [RS-EPT-CBR] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Bagg A., Neilands JB., 1987, Ferric uptake regulation protein acts as a repressor, employing iron (II) as a cofactor to bind the operator of an iron transport operon in Escherichia coli., Biochemistry 26(17):5471-7

 [2] Coy M., Neilands JB., 1991, Structural dynamics and functional domains of the fur protein., Biochemistry 30(33):8201-10

 [3] Hantke K., 1981, Regulation of ferric iron transport in Escherichia coli K12: isolation of a constitutive mutant., Mol Gen Genet 182(2):288-92

 [4] Saito T., Williams RJ., 1991, The binding of the ferric uptake regulation protein to a DNA fragment., Eur J Biochem 197(1):43-7

 [5] Schaffer S., Hantke K., Braun V., 1985, Nucleotide sequence of the iron regulatory gene fur., Mol Gen Genet 200(1):110-3

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB