RegulonDB RegulonDB 10.7: Gene Form
   

galK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

galK galT galM gpmA Fur Fur Spot42 galKp galKp TSS_936 TSS_936 galMp4 galMp4 TSS_935 (cluster) TSS_935 (cluster) TSS_934 (cluster) TSS_934 (cluster) TSS_933 TSS_933 TSS_932 TSS_932 TSS_931 TSS_931 gpmAp2 gpmAp2 gpmAp gpmAp TSS_928 TSS_928 TSS_927 TSS_927

Gene      
Name: galK    Texpresso search in the literature
Synonym(s): ECK0746, EG10363, b0757, galA
Genome position(nucleotides): 788831 <-- 789979 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.92
External database links:  
ASAP:
ABE-0002568
CGSC:
723
ECHOBASE:
EB0358
MIM:
230200
OU-MICROARRAY:
b0757
PORTECO:
galK
REGULONDB:
b0757
STRING:
511145.b0757
M3D: galK
COLOMBOS: galK
PortEco: b0757


Product      
Name: galactokinase
Synonym(s): GalA, GalK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 41.442
Isoelectric point: 5.13
Motif(s):
 
Type Positions Sequence
114 -> 181 DMVISGNVPQGAGLSSSASLEVAVGTVLQQLYHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISALG
11 -> 58 FANAFGYPATHTIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAP
124 -> 130 GAGLSSS
34 -> 37 EHTD
279 -> 361 ASALEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVKAVIGDKGGVRMTGGGFGGCIVALIPEELVPAVQQAVAEQYE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.2 - colanic acid (M antigen)
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.7 - galactose metabolism
  6 - cell structure --> 6.7 - capsule (M and K antigens)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0016301 - kinase activity
GO:0016773 - phosphotransferase activity, alcohol group as acceptor
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004335 - galactokinase activity
GO:0000287 - magnesium ion binding
GO:0005534 - galactose binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006012 - galactose metabolic process
GO:0016310 - phosphorylation
GO:0046835 - carbohydrate phosphorylation
GO:0033499 - galactose catabolic process via UDP-galactose
Note(s): Note(s): ...[more].
Reference(s): [1] Bork P., et al., 1993
[2] Debouck C., et al., 1985
[3] Hoffmeister D., et al., 2004
[4] Ji SC., et al., 2011
[5] Soffer RL. 1961
[6] Yang J., et al., 2003
[7] Yang J., et al., 2005
External database links:  
ECOCYC:
GALACTOKIN-MONOMER
ECOLIWIKI:
b0757
INTERPRO:
IPR006204
INTERPRO:
IPR036554
INTERPRO:
IPR000705
INTERPRO:
IPR006203
INTERPRO:
IPR022963
INTERPRO:
IPR006206
INTERPRO:
IPR013750
INTERPRO:
IPR014721
INTERPRO:
IPR019539
INTERPRO:
IPR019741
INTERPRO:
IPR020568
MODBASE:
P0A6T3
PANTHER:
PTHR10457:SF6
PFAM:
PF08544
PFAM:
PF10509
PFAM:
PF00288
PRIDE:
P0A6T3
PRINTS:
PR00473
PROSITE:
PS00106
PROSITE:
PS00627
PROTEINMODELPORTAL:
P0A6T3
REFSEQ:
NP_415278
SMR:
P0A6T3
UNIPROT:
P0A6T3


Operon      
Name: galETKM         
Operon arrangement:
Transcription unit        Promoter
galK
galE
galET
galETK
galETKM
galE
galET
galETK
galETKM
galETKM


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, GalS, GalR
Repressed by: CRP, H-NS, GalS, HU, GalR


Regulation by small RNA    
  Display Regulation
small RNA spf


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_927 787626 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_928 787629 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_931 787682 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_932 788845 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_933 788852 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_934 (cluster) 788855 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [8]
  promoter TSS_935 (cluster) 788865 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [8]
  promoter galMp4 788898 reverse Similarity to the consensus
Read more >
[ICWHO] [9]
  promoter TSS_936 789995 reverse nd [RS-EPT-CBR] [8]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Bork P., Sander C., Valencia A., 1993, Convergent evolution of similar enzymatic function on different protein folds: the hexokinase, ribokinase, and galactokinase families of sugar kinases., Protein Sci 2(1):31-40

 [2] Debouck C., Riccio A., Schumperli D., McKenney K., Jeffers J., Hughes C., Rosenberg M., Heusterspreute M., Brunel F., Davison J., 1985, Structure of the galactokinase gene of Escherichia coli, the last (?) gene of the gal operon., Nucleic Acids Res 13(6):1841-53

 [3] Hoffmeister D., Thorson JS., 2004, Mechanistic implications of Escherichia coli galactokinase structure-based engineering., Chembiochem 5(7):989-92

 [4] Ji SC., Wang X., Yun SH., Jeon HJ., Lee HJ., Kim H., Lim HM., 2011, In vivo transcription dynamics of the galactose operon: a study on the promoter transition from P1 to P2 at onset of stationary phase., PLoS One 6(3):e17646

 [5] Soffer RL., 1961, Enzymatic expression of genetic units of function concerned with galactose metabolism in Escherichia coli., J Bacteriol 82:471-8

 [6] Yang J., Fu X., Jia Q., Shen J., Biggins JB., Jiang J., Zhao J., Schmidt JJ., Wang PG., Thorson JS., 2003, Studies on the substrate specificity of Escherichia coli galactokinase., Org Lett 5(13):2223-6

 [7] Yang J., Fu X., Liao J., Liu L., Thorson JS., 2005, Structure-based engineering of E. coli galactokinase as a first step toward in vivo glycorandomization., Chem Biol 12(6):657-64

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [9] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB