RegulonDB RegulonDB 10.6.3: Gene Form
   

galR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lysA galR omrB GalS GalR OmpR anti-anti-terminator anti-terminator terminator anti-anti-terminator anti-terminator terminator TSS_3139 TSS_3139 galRp galRp omrBp omrBp

Gene      
Name: galR    Texpresso search in the literature
Synonym(s): ECK2835, EG10364, Rgal, b2837
Genome position(nucleotides): 2976599 --> 2977630 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.71
External database links:  
ASAP:
ABE-0009307
CGSC:
721
ECHOBASE:
EB0359
ECOCYC:
EG10364
ECOLIHUB:
galR
OU-MICROARRAY:
b2837
REGULONDB:
b2837
STRING:
511145.b2837
M3D: galR
COLOMBOS: galR
PortEco: b2837


Product      
Name: DNA-binding transcriptional dual regulator GalR
Synonym(s): GalR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: GalR/LacI
Cellular location: cytosol
Molecular weight: 37.094
Isoelectric point: 6.237
Motif(s):
 
Type Positions Sequence
4 -> 23 IKDVARLAGVSVATVSRVIN
168 -> 329 TRHLIQQGHTRIGYLCSNHSISDAEDRLQGYYDALAESGIAANDRLVTFGEPDESGGEQAMTELLGRGRNFTAVACYNDSMAAGAMGVLNDNGIDVPGEISLIGFDDVLVSRYVRPRLTTVRYPIVTMATQAAELALALADNRPLPEITNVFSPTLVRRHSV
1 -> 56 MATIKDVARLAGVSVATVSRVINNSPKASEASRLAVHSAMESLSYHPNANARALAQ
3 -> 48 TIKDVARLAGVSVATVSRVINNSPKASEASRLAVHSAMESLSYHPN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0042802 - identical protein binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006012 - galactose metabolic process
GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[IEP] Inferred from expression pattern
[IMP] Inferred from mutant phenotype
[IPI] Inferred from physical interaction
Reference(s): [1] Aki T., et al., 1997
[2] Choy HE., et al., 1997
[3] Hsieh M., et al., 1994
[4] Roy S., et al., 2005
[5] Roy S., et al., 2004
[6] Semsey S., et al., 2002
[7] Semsey S., et al., 2007
[8] Stragier P., et al., 1983
[9] Weickert MJ., et al., 1993
[10] von Wilcken-Bergmann B., et al., 1982
External database links:  
DIP:
DIP-9733N
ECOCYC:
PD03028
ECOLIWIKI:
b2837
INTERPRO:
IPR000843
INTERPRO:
IPR010982
INTERPRO:
IPR028082
MINT:
MINT-1295860
MODBASE:
P03024
PANTHER:
PTHR30146:SF7
PFAM:
PF00356
PRIDE:
P03024
PRINTS:
PR00036
PRODB:
PRO_000022747
PROSITE:
PS00356
PROSITE:
PS50932
PROTEINMODELPORTAL:
P03024
REFSEQ:
NP_417314
SMART:
SM00354
SMR:
P03024
UNIPROT:
P03024


Operon      
Name: galR         
Operon arrangement:
Transcription unit        Promoter
galR


Transcriptional Regulation      
Display Regulation             
Repressed by: GalS, GalR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3139 2977006 forward nd [RS-EPT-CBR] [11]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Aki T., Adhya S., 1997, Repressor induced site-specific binding of HU for transcriptional regulation., EMBO J 16(12):3666-74

 [2] Choy HE., Hanger RR., Aki T., Mahoney M., Murakami K., Ishihama A., Adhya S., 1997, Repression and activation of promoter-bound RNA polymerase activity by Gal repressor., J Mol Biol 272(3):293-300

 [3] Hsieh M., Hensley P., Brenowitz M., Fetrow JS., 1994, A molecular model of the inducer binding domain of the galactose repressor of Escherichia coli., J Biol Chem 269(19):13825-35

 [4] Roy S., Dimitriadis EK., Kar S., Geanacopoulos M., Lewis MS., Adhya S., 2005, Gal repressor-operator-HU ternary complex: pathway of repressosome formation., Biochemistry 44(14):5373-80

 [5] Roy S., Semsey S., Liu M., Gussin GN., Adhya S., 2004, GalR represses galP1 by inhibiting the rate-determining open complex formation through RNA polymerase contact: a GalR negative control mutant., J Mol Biol 344(3):609-18

 [6] Semsey S., Geanacopoulos M., Lewis DE., Adhya S., 2002, Operator-bound GalR dimers close DNA loops by direct interaction: tetramerization and inducer binding., EMBO J 21(16):4349-56

 [7] Semsey S., Krishna S., Sneppen K., Adhya S., 2007, Signal integration in the galactose network of Escherichia coli., Mol Microbiol 65(2):465-76

 [8] Stragier P., Danos O., Patte JC., 1983, Regulation of diaminopimelate decarboxylase synthesis in Escherichia coli. II. Nucleotide sequence of the lysA gene and its regulatory region., J Mol Biol 168(2):321-31

 [9] Weickert MJ., Adhya S., 1993, The galactose regulon of Escherichia coli., Mol Microbiol 10(2):245-51

 [10] von Wilcken-Bergmann B., Muller-Hill B., 1982, Sequence of galR gene indicates a common evolutionary origin of lac and gal repressor in Escherichia coli., Proc Natl Acad Sci U S A 79(8):2427-31

 [11] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB