RegulonDB RegulonDB 10.7: Gene Form
   

galS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yeiB galS mglB GalS GalR CRP GalR GalS GalS GalR CRP galSp galSp mglBp mglBp mglAp mglAp

Gene      
Name: galS    Texpresso search in the literature
Synonym(s): ECK2144, EG10365, b2151, mglD
Genome position(nucleotides): 2240628 <-- 2241668 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.45
External database links:  
ASAP:
ABE-0007110
CGSC:
499
ECHOBASE:
EB0360
OU-MICROARRAY:
b2151
PORTECO:
galS
REGULONDB:
b2151
STRING:
511145.b2151
M3D: galS
COLOMBOS: galS
PortEco: b2151


Shine dalgarno      
Sequence: atctcataacAGGTAGtgaaTAT


Product      
Name: DNA-binding transcriptional dual regulator GalS
Synonym(s): GalS, MglD
Sequence: Get amino acid sequence Fasta Format
Regulator Family: GalR/LacI
Cellular location: cytosol
Molecular weight: 37.357
Isoelectric point: 6.678
Motif(s):
 
Type Positions Sequence
169 -> 329 RMLLNNGHQRIGYLSSSHGIEDDAMRKAGWMSALKEQDIIPPESWIGAGTPDMPGGEAAMVELLGRNLQLTAVFAYNDNMAAGALTALKDNGIAIPLHLSIIGFDDIPIARYTDPQLTTVRYPIASMAKLATELALQGAAGNIDPRASHCFMPTLVRRHSV
1 -> 56 MITIRDVARQAGVSVATVSRVLNNSTLVSADTREAVMKAVSELDYRPNANAQALAT
4 -> 23 IRDVARQAGVSVATVSRVLN
3 -> 48 TIRDVARQAGVSVATVSRVLNNSTLVSADTREAVMKAVSELDYRPN
104 -> 105 ER

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[HIFS] Human inference of function from sequence
[IEP] Inferred from expression pattern
[IMP] Inferred from mutant phenotype
Reference(s): [1] Geanacopoulos M., et al., 1997
[2] Vermes I., et al., 1991
[3] Weickert MJ., et al., 1992
[4] Weickert MJ., et al., 1993
[5] Weickert MJ., et al., 1993
External database links:  
DIP:
DIP-9734N
ECOCYC:
PD00261
ECOLIWIKI:
b2151
INTERPRO:
IPR000843
INTERPRO:
IPR028082
INTERPRO:
IPR010982
MODBASE:
P25748
PANTHER:
PTHR30146:SF7
PFAM:
PF00356
PRIDE:
P25748
PRINTS:
PR00036
PRODB:
PRO_000022748
PROSITE:
PS50932
PROSITE:
PS00356
PROTEINMODELPORTAL:
P25748
REFSEQ:
NP_416656
SMART:
SM00354
SMR:
P25748
UNIPROT:
P25748


Operon      
Name: galS         
Operon arrangement:
Transcription unit        Promoter
galS


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: GalS, GalR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Geanacopoulos M., Adhya S., 1997, Functional characterization of roles of GalR and GalS as regulators of the gal regulon., J Bacteriol 179(1):228-34

 [2] Vermes I., Bonte HA., v d Sluijs Veer G., Schoemaker J., 1991, Interpretations of five monoclonal immunoassays of lutropin and follitropin: effects of normalization with WHO standard., Clin Chem 37(3):415-21

 [3] Weickert MJ., Adhya S., 1992, Isorepressor of the gal regulon in Escherichia coli., J Mol Biol 226(1):69-83

 [4] Weickert MJ., Adhya S., 1993, The galactose regulon of Escherichia coli., Mol Microbiol 10(2):245-51

 [5] Weickert MJ., Adhya S., 1993, Control of transcription of gal repressor and isorepressor genes in Escherichia coli., J Bacteriol 175(1):251-8


RegulonDB