RegulonDB RegulonDB 10.6.3: Gene Form
   

galT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

galK galT galE galM GalR GalS Spot42 galKp galKp TSS_936 TSS_936 galMp4 galMp4 TSS_935 (cluster) TSS_935 (cluster) TSS_934 (cluster) TSS_934 (cluster) TSS_933 TSS_933 TSS_932 TSS_932

Gene      
Name: galT    Texpresso search in the literature
Synonym(s): ECK0747, EG10366, b0758, galB
Genome position(nucleotides): 789983 <-- 791029 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.78
External database links:  
ASAP:
ABE-0002573
CGSC:
720
ECHOBASE:
EB0361
ECOCYC:
EG10366
ECOLIHUB:
galT
MIM:
230400
OU-MICROARRAY:
b0758
REGULONDB:
b0758
STRING:
511145.b0758
M3D: galT
COLOMBOS: galT
PortEco: b0758


Product      
Name: galactose-1-phosphate uridylyltransferase
Synonym(s): GalB, GalT
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.646
Isoelectric point: 6.453
Motif(s):
 
Type Positions Sequence
159 -> 161 GCS
55 -> 55 C
3 -> 176 QFNPVDHPHRRYNPLTGQWILVSPHRAKRPWQGAQETPAKQVLPAHDPDCFLCAGNVRVTGDKNPDYTGTYVFTNDFAALMSDTPDAPESHDPLMRCQSARGTSRVICFSPDHSKTLPELSVAALTEIVKTWQEQTAELGKTYPWVQVFENKGAAMGCSNPHPHGQIWANSFLP
316 -> 317 YE
28 -> 31 RAKR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.2 - colanic acid (M antigen)
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.7 - galactose metabolism
  6 - cell structure --> 6.7 - capsule (M and K antigens)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016779 - nucleotidyltransferase activity
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
GO:0004335 - galactokinase activity
GO:0008108 - UDP-glucose:hexose-1-phosphate uridylyltransferase activity
GO:0008198 - ferrous iron binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006012 - galactose metabolic process
GO:0046835 - carbohydrate phosphorylation
GO:0033499 - galactose catabolic process via UDP-galactose
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9735N
ECOCYC:
GALACTURIDYLYLTRANS-MONOMER
ECOLIWIKI:
b0758
INTERPRO:
IPR036265
INTERPRO:
IPR019779
INTERPRO:
IPR005850
INTERPRO:
IPR005849
INTERPRO:
IPR001937
MODBASE:
P09148
PANTHER:
PTHR11943
PDB:
1GUP
PDB:
1GUQ
PDB:
1HXP
PDB:
1HXQ
PFAM:
PF01087
PFAM:
PF02744
PRIDE:
P09148
PROSITE:
PS00117
PROTEINMODELPORTAL:
P09148
REFSEQ:
NP_415279
SMR:
P09148
UNIPROT:
P09148


Operon      
Name: galETKM         
Operon arrangement:
Transcription unit        Promoter
galK
galE
galET
galETK
galETKM
galE
galET
galETK
galETKM
galETKM


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, GalS, GalR
Repressed by: CRP, H-NS, GalS, HU, GalR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_932 788845 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_933 788852 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_934 (cluster) 788855 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_935 (cluster) 788865 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter galMp4 788898 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_936 789995 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB