RegulonDB RegulonDB 10.8: Gene Form
   

gapA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gapA yeaD msrB Cra CRP Cra terminator anti-terminator anti-anti-terminator TSS_2120 TSS_2120 TSS_2119 TSS_2119 TSS_2118 TSS_2118 TSS_2117 TSS_2117 TSS_2116 (cluster) TSS_2116 (cluster) TSS_2115 TSS_2115 TSS_2114 TSS_2114 TSS_2113 TSS_2113 TSS_2112 (cluster) TSS_2112 (cluster) TSS_2111 (cluster) TSS_2111 (cluster) TSS_2110 TSS_2110 TSS_2109 TSS_2109 TSS_2108 TSS_2108 TSS_2107 TSS_2107 TSS_2106 (cluster) TSS_2106 (cluster) TSS_2105 TSS_2105 TSS_2104 TSS_2104 TSS_2103 (cluster) TSS_2103 (cluster) TSS_2102 TSS_2102 TSS_2101 TSS_2101 TSS_2100 TSS_2100 TSS_2099 TSS_2099 TSS_2098 TSS_2098 TSS_2097 TSS_2097 TSS_2096 TSS_2096 TSS_2095 (cluster) TSS_2095 (cluster) TSS_2094 TSS_2094 TSS_2093 (cluster) TSS_2093 (cluster) TSS_2092 TSS_2092 TSS_2091 TSS_2091 TSS_2090 TSS_2090 TSS_2089 TSS_2089 TSS_2088 TSS_2088 TSS_2087 (cluster) TSS_2087 (cluster) TSS_2086 (cluster) TSS_2086 (cluster) TSS_2085 TSS_2085 TSS_2084 TSS_2084 TSS_2083 TSS_2083 TSS_2082 (cluster) TSS_2082 (cluster) TSS_2081 (cluster) TSS_2081 (cluster) gapAp1 gapAp1 gapAp2 gapAp2 gapAp3 gapAp3 msrBp5 msrBp5 gapAp4 gapAp4 msrBp6 msrBp6 gapAp6 gapAp6 gapAp7 gapAp7

Gene      
Name: gapA    Texpresso search in the literature
Synonym(s): ECK1777, EG10367, b1779, gad, gap1
Genome position(nucleotides): 1862771 --> 1863766 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.0
Reference(s): [1] Seta FD., et al., 1997
[2] Yang Y., et al., 1998
External database links:  
ASAP:
ABE-0005920
ECHOBASE:
EB0362
OU-MICROARRAY:
b1779
PortEco:
gapA
STRING:
511145.b1779
COLOMBOS: gapA


Product      
Name: glyceraldehyde-3-phosphate dehydrogenase A
Synonym(s): Gad, Gap1, GapA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 35.532
Isoelectric point: 7.132
Motif(s):
 
Type Positions Sequence
177 -> 177 H
12 -> 13 RI
43 -> 43 Y
155 -> 312 LAPLAKVINDNFGIIEGLMTTVHATTATQKTVDGPSHKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNVSVVDLTVRLEKAATYEQIKAAVKAAAEGEMKGVLGYTEDDVVSTDFNGEVCTSVFDAKAGIALNDNFVKLVSWY
267 -> 267 E

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.1 - glycolysis
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.6 - pyridoxal 5'phosphate
  1 - metabolism --> 1.7 - central intermediary metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016491 - oxidoreductase activity
GO:0000166 - nucleotide binding
GO:0016620 - oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0004365 - glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
GO:0050661 - NADP binding
GO:0051287 - NAD binding
biological_process GO:0006006 - glucose metabolic process
GO:0006096 - glycolytic process
GO:0055114 - oxidation-reduction process
External database links:  
DIP:
DIP-31848N
ECOCYC:
GAPDH-A-MONOMER
ECOLIWIKI:
b1779
INTERPRO:
IPR020830
INTERPRO:
IPR020829
INTERPRO:
IPR020831
INTERPRO:
IPR020828
INTERPRO:
IPR006424
INTERPRO:
IPR036291
MINT:
P0A9B2
PANTHER:
PTHR10836
PDB:
6IOJ
PDB:
6IO6
PDB:
6IO4
PDB:
2VYV
PDB:
2VYN
PDB:
1S7C
PDB:
1GAE
PDB:
1GAD
PDB:
1DC6
PDB:
1DC5
PDB:
1DC4
PDB:
1DC3
PDB:
5ZA0
PFAM:
PF00044
PFAM:
PF02800
PRIDE:
P0A9B2
PRINTS:
PR00078
PRODB:
PRO_000022749
PROSITE:
PS00071
REFSEQ:
NP_416293
SMART:
SM00846
SMR:
P0A9B2
UNIPROT:
P0A9B2


Operon      
Name: gapA-yeaD         
Operon arrangement:
Transcription unit        Promoter
gapA
gapA
gapA
gapA
gapA-yeaD
gapA
 


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: Cra


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter msrBp5 1862584 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_2081 (cluster) 1862738 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_2082 (cluster) 1862743 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_2083 1862751 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2084 1862755 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2085 1862771 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2086 (cluster) 1862774 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_2087 (cluster) 1862788 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_2088 1862797 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2089 1862804 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2090 1862847 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2091 1862947 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2092 1862959 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2093 (cluster) 1862961 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_2094 1863001 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2095 (cluster) 1863006 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_2096 1863012 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2097 1863021 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2098 1863027 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2099 1863087 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2100 1863184 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2101 1863237 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2102 1863241 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2103 (cluster) 1863253 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_2104 1863264 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2105 1863314 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2106 (cluster) 1863369 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_2107 1863446 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2108 1863455 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2109 1863467 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2110 1863477 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2111 (cluster) 1863480 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_2112 (cluster) 1863483 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_2113 1863495 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2114 1863581 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2115 1863598 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2116 (cluster) 1863618 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_2117 1863646 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2118 1863824 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2119 1863836 forward nd [RS-EPT-CBR] [4]
  promoter TSS_2120 1864487 forward nd [RS-EPT-CBR] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Seta FD., Boschi-Muller S., Vignais ML., Branlant G., 1997, Characterization of Escherichia coli strains with gapA and gapB genes deleted., J Bacteriol 179(16):5218-21

 [2] Yang Y., Zhao G., Man TK., Winkler ME., 1998, Involvement of the gapA- and epd (gapB)-encoded dehydrogenases in pyridoxal 5'-phosphate coenzyme biosynthesis in Escherichia coli K-12., J Bacteriol 180(16):4294-9

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB