RegulonDB RegulonDB 10.8: Gene Form
   

gdhA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gdhA ynjI ynjH nudG Nac Nac Nac CRP ArgP Nac ArgP TSS_2070 TSS_2070 TSS_2069 TSS_2069 TSS_2068 TSS_2068 TSS_2067 TSS_2067 TSS_2066 TSS_2066 TSS_2065 TSS_2065 gdhAp1 gdhAp1 ynjHp2 ynjHp2 ynjHp ynjHp

Gene      
Name: gdhA    Texpresso search in the literature
Synonym(s): ECK1759, EG10372, b1761
Genome position(nucleotides): 1842371 --> 1843714 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.27
External database links:  
ASAP:
ABE-0005865
CGSC:
712
ECHOBASE:
EB0367
OU-MICROARRAY:
b1761
PortEco:
gdhA
STRING:
511145.b1761
COLOMBOS: gdhA


Product      
Name: glutamate dehydrogenase
Synonym(s): GdhA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 48.581
Isoelectric point: 6.364
Motif(s):
 
Type Positions Sequence
57 -> 184 PERVIQFRVVWVDDRNQIQVNRAWRVQFSSAIGPYKGGMRFHPSVNLSILKFLGFEQTFKNALTTLPMGGGKGGSDFDPKGKSEGEVMRFCQALMTELYRHLGADTDVPAGDIGVGGREVGFMAGMMK
385 -> 385 A
202 -> 445 GGSLIRPEATGYGLVYFTEAMLKRHGMGFEGMRVSVSGSGNVAQYAIEKAMEFGARVITASDSSGTVVDESGFTKEKLARLIEIKASRDGRVADYAKEFGLVYLEGQQPWSLPVDIALPCATQNELDVDAAHQLIANGVKAVAEGANMPTTIEATELFQQAGVLFAPGKAANAGGVATSGLEMAQNAARLGWKAEKVDARLHHIMLDIHHACVEHGGEGEQTNYVQGANIAGFVKVADAMLAQG
92 -> 92 K
128 -> 128 K

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.1 - glutamate
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0016639 - oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor
GO:0004354 - glutamate dehydrogenase (NADP+) activity
GO:0042802 - identical protein binding
biological_process GO:0006520 - cellular amino acid metabolic process
GO:0006537 - glutamate biosynthetic process
GO:0055114 - oxidation-reduction process
External database links:  
DIP:
DIP-9756N
ECOCYC:
GDHA-MONOMER
ECOLIWIKI:
b1761
INTERPRO:
IPR033524
INTERPRO:
IPR033922
INTERPRO:
IPR014362
INTERPRO:
IPR006097
INTERPRO:
IPR006096
INTERPRO:
IPR006095
INTERPRO:
IPR036291
MINT:
P00370
MODBASE:
P00370
PDB:
4BHT
PDB:
2YFH
PDB:
3SBO
PFAM:
PF00208
PFAM:
PF02812
PRIDE:
P00370
PRINTS:
PR00082
PRODB:
PRO_000022767
PROSITE:
PS00074
REFSEQ:
NP_416275
SMART:
SM00839
SMR:
P00370
SWISSMODEL:
P00370
UNIPROT:
P00370


Operon      
Name: gdhA         
Operon arrangement:
Transcription unit        Promoter
gdhA


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, Fur, ArgP
Repressed by: Nac, CRP, Fur


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2065 1842321 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2066 1842327 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2067 1842332 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2068 1842691 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2069 1843057 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2070 1843063 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB