RegulonDB RegulonDB 10.9: Gene Form
   

glgC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glgP glgX glgA glgC glgB ppGpp ppGpp anti-anti-terminator anti-terminator TSS_4043 TSS_4043 TSS_4042 TSS_4042 TSS_4041 TSS_4041 glgCp3 glgCp3 TSS_4040 (cluster) TSS_4040 (cluster) glgCp2 glgCp2 glgCp1 glgCp1 TSS_4039 TSS_4039 TSS_4038 TSS_4038 TSS_4037 TSS_4037 TSS_4036 TSS_4036 TSS_4035 TSS_4035 TSS_4034 TSS_4034 glgAp glgAp TSS_4033 TSS_4033 TSS_4032 TSS_4032 TSS_4031 TSS_4031 glgPp1 glgPp1 TSS_4030 TSS_4030 TSS_4029 TSS_4029 TSS_4028 TSS_4028 TSS_4027 TSS_4027

Gene      
Name: glgC    Texpresso search in the literature
Synonym(s): ECK3416, EG10379, b3430
Genome position(nucleotides): 3568033 <-- 3569328 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.62
External database links:  
ASAP:
ABE-0011204
CGSC:
708
ECHOBASE:
EB0374
ECOLIHUB:
glgC
OU-MICROARRAY:
b3430
STRING:
511145.b3430
COLOMBOS: glgC


Product      
Name: glucose-1-phosphate adenylyltransferase
Synonym(s): GlgC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 48.698
Isoelectric point: 6.033
Motif(s):
 
Type Positions Sequence
22 -> 291 ALILAGGRGTRLKDLTNKRAKPAVHFGGKFRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWSFFNEEMNEFVDLLPAQQRMKGENWYRGTADAVTQNLDIIRRYKAEYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVPIEEASAFGVMAVDENDKIIEFVEKPANPPSMPNDPSKSLASMGIYVFDADYLYELLEEDDRDENSSHDFGKDLIPKITEAGLAYAHPFPLSCVQSDPDAEPYWRDVGTLEAYWKANLDLA
39 -> 39 K
189 -> 189 I
2 -> 431 VSLEKNDHLMLARQLPLKSVALILAGGRGTRLKDLTNKRAKPAVHFGGKFRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWSFFNEEMNEFVDLLPAQQRMKGENWYRGTADAVTQNLDIIRRYKAEYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVPIEEASAFGVMAVDENDKIIEFVEKPANPPSMPNDPSKSLASMGIYVFDADYLYELLEEDDRDENSSHDFGKDLIPKITEAGLAYAHPFPLSCVQSDPDAEPYWRDVGTLEAYWKANLDLASVVPELDMYDRNWPIRTYNESLPPAKFVQDRSGSHGMTLNSLVSGGCVISGSVVVQSVLFSRVRVNSFCNIDSAVLLPEVWVGRSCRLRRCVIDRACVIPEGMVIGENAEEDARRFYRSEEGIVLVTREMLRKLGHKQER
296 -> 296 E

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.9 - cytoplasmic polysaccharides
Gene Ontology Terms (GO)  
cellular_component GO:0010170 - glucose-1-phosphate adenylyltransferase complex
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016779 - nucleotidyltransferase activity
GO:0016740 - transferase activity
GO:0008878 - glucose-1-phosphate adenylyltransferase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000287 - magnesium ion binding
GO:0016208 - AMP binding
GO:0042802 - identical protein binding
biological_process GO:0008152 - metabolic process
GO:0005975 - carbohydrate metabolic process
GO:0009058 - biosynthetic process
GO:0005977 - glycogen metabolic process
GO:0005978 - glycogen biosynthetic process
GO:0051289 - protein homotetramerization
Note(s): Note(s): ...[more].
Reference(s): [1] Adamson DN., et al., 2013
[2] Almagro G., et al., 2015
[3] Diez MD., et al., 2013
External database links:  
DIP:
DIP-48147N
ECOCYC:
GLUC1PADENYLTRANS-MONOMER
ECOLIWIKI:
b3430
INTERPRO:
IPR011004
INTERPRO:
IPR005835
INTERPRO:
IPR011831
INTERPRO:
IPR023049
INTERPRO:
IPR029044
INTERPRO:
IPR005836
PDB:
6SI8
PDB:
6SHQ
PDB:
6SHN
PDB:
6SHJ
PDB:
6R8U
PDB:
6R8B
PDB:
5MNI
PDB:
5L6V
PDB:
5L6S
PFAM:
PF00483
PRIDE:
P0A6V1
PRODB:
PRO_000022777
PROSITE:
PS00808
PROSITE:
PS00809
PROSITE:
PS00810
REFSEQ:
NP_417888
SMR:
P0A6V1
UNIPROT:
P0A6V1


Operon      
Name: glgBXCAP         
Operon arrangement:
Transcription unit        Promoter
glgAP
glgCAP
glgCAP
glgCAP
glgBXCAP


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, PhoP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4027 3564324 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4028 3565337 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4029 3565453 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4030 3566562 reverse nd [RS-EPT-CBR] [4]
  promoter glgPp1 3566773 reverse Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter TSS_4031 3567478 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4032 3567563 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4033 3567895 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4034 3568396 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4035 3568634 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4036 3568661 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4037 3568712 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4038 3568714 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4039 3569225 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4040 (cluster) 3569457 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_4041 3570215 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4042 3570251 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_4043 3570750 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Adamson DN., Lim HN., 2013, Rapid and robust signaling in the CsrA cascade via RNA-protein interactions and feedback regulation., Proc Natl Acad Sci U S A 110(32):13120-5

 [2] Almagro G., Viale AM., Montero M., Rahimpour M., Munoz FJ., Baroja-Fernandez E., Bahaji A., Zuniga M., Gonzalez-Candelas F., Pozueta-Romero J., 2015, Comparative genomic and phylogenetic analyses of Gammaproteobacterial glg genes traced the origin of the Escherichia coli glycogen glgBXCAP operon to the last common ancestor of the sister orders Enterobacteriales and Pasteurellales., PLoS One 10(1):e0115516

 [3] Diez MD., Ebrecht AC., Martinez LI., Aleanzi MC., Guerrero SA., Ballicora MA., Iglesias AA., 2013, A Chimeric UDP-glucose pyrophosphorylase produced by protein engineering exhibits sensitivity to allosteric regulators., Int J Mol Sci 14(5):9703-21

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB