RegulonDB RegulonDB 10.7: Gene Form
   

glnP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybiO glnH glnQ glnP rlmF TSS_969 TSS_969 TSS_968 TSS_968 TSS_967 TSS_967 TSS_966 TSS_966 glnQp glnQp TSS_965 TSS_965 TSS_964 TSS_964 TSS_963 TSS_963 ybiOp5 ybiOp5 ybiOp2 ybiOp2

Gene      
Name: glnP    Texpresso search in the literature
Synonym(s): ECK0799, EG10388, b0810
Genome position(nucleotides): 846460 <-- 847119 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.48
External database links:  
ASAP:
ABE-0002766
CGSC:
700
ECHOBASE:
EB0383
OU-MICROARRAY:
b0810
PORTECO:
glnP
REGULONDB:
b0810
STRING:
511145.b0810
M3D: glnP
COLOMBOS: glnP
PortEco: b0810


Product      
Name: L-glutamine ABC transporter membrane subunit
Synonym(s): GlnP
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 24.364
Isoelectric point: 10.657
Motif(s):
 
Type Positions Sequence
188 -> 208 LEIWSAVAVFYLIITLVLSFI
89 -> 109 PFTAAVVTIMINSGAYIAEIT
54 -> 74 VALVFIEVIRGTPIVVQVMFI
33 -> 217 GLVIGLLAGFARTFGGWIANHVALVFIEVIRGTPIVVQVMFIYFALPMAFNDLRIDPFTAAVVTIMINSGAYIAEITRGAVLSIHKGFREAGLALGLSRWETIRYVILPLALRRMLPPLGNQWIISIKDTSLFIVIGVAELTRQGQEIIAGNFRALEIWSAVAVFYLIITLVLSFILRRLERRMK
151 -> 171 LGNQWIISIKDTSLFIVIGVA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.2 - glutamine
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0022857 - transmembrane transporter activity
GO:0015186 - L-glutamine transmembrane transporter activity
biological_process GO:0006865 - amino acid transport
GO:0055085 - transmembrane transport
GO:0071705 - nitrogen compound transport
GO:0006868 - glutamine transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
DIP:
DIP-47993N
ECOCYC:
GLNP-MONOMER
ECOLIWIKI:
b0810
INTERPRO:
IPR000515
INTERPRO:
IPR010065
INTERPRO:
IPR035906
PFAM:
PF00528
PRIDE:
P0AEQ6
PRODB:
PRO_000022790
PROSITE:
PS50928
PROTEINMODELPORTAL:
P0AEQ6
REFSEQ:
NP_415331
SMR:
P0AEQ6
UNIPROT:
P0AEQ6


Operon      
Name: glnHPQ         
Operon arrangement:
Transcription unit        Promoter
glnQ
glnHPQ
glnHPQ


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, NtrC
Repressed by: NtrC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybiOp2 845509 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybiOp5 845664 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_963 845736 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_964 846498 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_965 846624 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_966 846763 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_967 846774 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_968 846807 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_969 847113 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB