RegulonDB RegulonDB 10.7: Gene Form
   

glnQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybiO glnH glnQ glnP rlmF TSS_969 TSS_969 TSS_968 TSS_968 TSS_967 TSS_967 TSS_966 TSS_966 glnQp glnQp TSS_965 TSS_965 TSS_964 TSS_964 TSS_963 TSS_963 ybiOp5 ybiOp5 ybiOp2 ybiOp2

Gene      
Name: glnQ    Texpresso search in the literature
Synonym(s): ECK0798, EG10389, b0809
Genome position(nucleotides): 845741 <-- 846463 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.94
External database links:  
ASAP:
ABE-0002764
CGSC:
18268
ECHOBASE:
EB0384
OU-MICROARRAY:
b0809
PORTECO:
glnQ
REGULONDB:
b0809
STRING:
511145.b0809
M3D: glnQ
COLOMBOS: glnQ
PortEco: b0809


Product      
Name: L-glutamine ABC transporter ATP binding subunit
Synonym(s): GlnQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 26.731
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
157 -> 164 MMLFDEPT
2 -> 236 IEFKNVSKHFGPTQVLHNIDLNIAQGEVVVIIGPSGSGKSTLLRCINKLEEITSGDLIVDGLKVNDPKVDERLIRQEAGMVFQQFYLFPHLTALENVMFGPLRVRGANKEEAEKLARELLAKVGLAERAHHYPSELSGGQQQRVAIARALAVKPKMMLFDEPTSALDPELRHEVLKVMQDLAEEGMTMVIVTHEIGFAEKVASRLIFIDKGRIAEDGNPQVLIKNPPSQRLQEFL
137 -> 140 LSGG
17 -> 165 LHNIDLNIAQGEVVVIIGPSGSGKSTLLRCINKLEEITSGDLIVDGLKVNDPKVDERLIRQEAGMVFQQFYLFPHLTALENVMFGPLRVRGANKEEAEKLARELLAKVGLAERAHHYPSELSGGQQQRVAIARALAVKPKMMLFDEPTS
34 -> 41 GPSGSGKS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.2 - glutamine
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015424 - ATPase-coupled amino acid transmembrane transporter activity
GO:0015186 - L-glutamine transmembrane transporter activity
biological_process GO:0006865 - amino acid transport
GO:0003333 - amino acid transmembrane transport
GO:0006868 - glutamine transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9786N
ECOCYC:
GLNQ-MONOMER
ECOLIWIKI:
b0809
INTERPRO:
IPR003439
INTERPRO:
IPR030679
INTERPRO:
IPR003593
INTERPRO:
IPR017871
INTERPRO:
IPR027417
MODBASE:
P10346
PFAM:
PF00005
PRIDE:
P10346
PRODB:
PRO_000022791
PROSITE:
PS50893
PROSITE:
PS00211
PROTEINMODELPORTAL:
P10346
REFSEQ:
NP_415330
SMART:
SM00382
SMR:
P10346
SWISSMODEL:
P10346
UNIPROT:
P10346


Operon      
Name: glnHPQ         
Operon arrangement:
Transcription unit        Promoter
glnQ
glnHPQ
glnHPQ


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, NtrC
Repressed by: NtrC, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybiOp2 845509 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybiOp5 845664 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_963 845736 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_964 846498 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_965 846624 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_966 846763 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_967 846774 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_968 846807 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_969 847113 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB