RegulonDB RegulonDB 10.6.3: Gene Form
   

glpC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glpA glpB glpC rpnE terminator anti-terminator anti-anti-terminator yfaDp5 yfaDp5

Gene      
Name: glpC    Texpresso search in the literature
Synonym(s): ECK2235, EG10393, b2243
Genome position(nucleotides): 2355521 --> 2356711 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.99
External database links:  
ASAP:
ABE-0007426
CGSC:
17692
ECHOBASE:
EB0388
ECOCYC:
EG10393
ECOLIHUB:
glpC
OU-MICROARRAY:
b2243
REGULONDB:
b2243
STRING:
511145.b2243
M3D: glpC
COLOMBOS: glpC
PortEco: b2243


Product      
Name: anaerobic glycerol-3-phosphate dehydrogenase subunit C
Synonym(s): GlpC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 44.108
Isoelectric point: 8.521
Motif(s):
 
Type Positions Sequence
2 -> 29 NDTSFENCIKCTVCTTACPVSRVNPGYP
206 -> 206 L
293 -> 376 VVYHTPCHMEKMGWTLYTLELLRNIPGLELTVLDSQCCGIAGTYGFKKENYPTSQAIGAPLFRQIEESGADLVVTDCETCKWQI
6 -> 70 FENCIKCTVCTTACPVSRVNPGYPGPKQAGPDGERLRLKDGALYDEALKYCINCKRCEVACPSDV
163 -> 249 VAFFHGCFVNYNHPQLGKDLIKVLNAMGTGVQLLSKEKCCGVPLIANGFTDKARKQAITNVESIREAVGVKGIPVIATSSTCTFALR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.6 - misc. glycerol metabolism
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0009331 - glycerol-3-phosphate dehydrogenase complex
molecular_function GO:0046872 - metal ion binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0004368 - glycerol-3-phosphate dehydrogenase (quinone) activity
biological_process GO:0009061 - anaerobic respiration
GO:0019563 - glycerol catabolic process
GO:0046168 - glycerol-3-phosphate catabolic process
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Lan J., et al., 2003
[2] Shimizu K., et al., 2005
External database links:  
DIP:
DIP-35835N
ECOCYC:
ANGLYC3PDEHYDROGSUBUNITC-MONOMER
ECOLIWIKI:
b2243
INTERPRO:
IPR017896
INTERPRO:
IPR017900
INTERPRO:
IPR017753
INTERPRO:
IPR009051
INTERPRO:
IPR004017
MODBASE:
P0A996
PFAM:
PF13183
PFAM:
PF02754
PRIDE:
P0A996
PRODB:
PRO_000022794
PROSITE:
PS51379
PROSITE:
PS00198
PROTEINMODELPORTAL:
P0A996
REFSEQ:
NP_416746
SMR:
P0A996
UNIPROT:
P0A996


Operon      
Name: glpABC         
Operon arrangement:
Transcription unit        Promoter
glpABC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FNR, FlhDC, Fis
Repressed by: ArcA, GlpR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yfaDp5 2356690 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Lan J., Newman EB., 2003, A requirement for anaerobically induced redox functions during aerobic growth of Escherichia coli with serine, glycine and leucine as carbon source., Res Microbiol 154(3):191-7

 [2] Shimizu K., Hayashi S., Kako T., Suzuki M., Tsukagoshi N., Doukyu N., Kobayashi T., Honda H., 2005, Discovery of glpC, an organic solvent tolerance-related gene in Escherichia coli, using gene expression profiles from DNA microarrays., Appl Environ Microbiol 71(2):1093-6

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB