RegulonDB RegulonDB 9.3: Gene Form
   

glpD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glpD glpE yzgL GlpR GlpR GlpR GlpR CRP glpDp glpDp glpEp glpEp

Gene      
Name: glpD    Texpresso search in the literature
Synonym(s): ECK3412, b3426, glyD
Genome position(nucleotides): 3562013 --> 3563518 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.05
Reference(s): [1] Persson M., et al., 2000
External database links:  
OU-MICROARRAY:
b3426
M3D: glpD
COLOMBOS: glpD
PortEco: b3426


Product      
Name: glycerol-3-phosphate dehydrogenase, aerobic
Synonym(s): GlpD, GlyD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 56.751
Isoelectric point: 7.49
Motif(s):
 
Type Positions Sequence
5 -> 323 DLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYEFRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGSTGLRFGANSVLKPEIKRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENGLWIVEAEDIDTGKKYSWQARGLVNATGPWVKQFFDDGMHLPSPYGIRLIKGSHIVVPRVHTQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLNVYNTHFKKQLSRDDIVWTYSGVRPLCDDE
381 -> 497 TKESVLPGGAIEGDRDDYAARLRRRYPFLTESLARHYARTYGSNSELLLGNAGTVSDLGEDFGHEFYEAELKYLVDHEWVRRADDALWRRTKQGMWLNADQQSRVSQWLVEYTQQRL
464 -> 501 DDALWRRTKQGMWLNADQQSRVSQWLVEYTQQRLSLAS
328 -> 353 QAITRDYTLDIHDENGKAPLLSVFGG
23 -> 23 A

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.6 - misc. glycerol metabolism
Gene Ontology Terms (GO)  
External database links:  
ECOCYC:
AERGLYC3PDEHYDROG-MONOMER
EXPASY:
EC-1.1.5.3
GENPROTEC:
b3426
PDB:
2R4J
PDB:
2R4E
PDB:
2R46
PDB:
2QCU
PDB:
2R45


Operon      
Name: glpD         
Operon arrangement:
Transcription unit        Promoter
glpD


Transcriptional Regulation      
Display Regulation             
Note: The TF binding sites with unknown position are not displayed in the graphic.
Activated by: CRP
Repressed by: ArcA, GlpR


Reference(s)    

 [1] Persson M., Glatz E., Rutberg B., 2000, Different processing of an mRNA species in Bacillus subtilis and Escherichia coli., J Bacteriol. 182(3):689-95


RegulonDB