RegulonDB RegulonDB 10.6.3: Gene Form
   

glpD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glpD glpE yzgL GlpR GlpR GlpR GlpR CRP glpDp glpDp glpEp glpEp

Gene      
Name: glpD    Texpresso search in the literature
Synonym(s): ECK3412, EG10394, b3426, glyD
Genome position(nucleotides): 3562013 --> 3563518 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.05
Reference(s): [1] Persson M., et al., 2000
External database links:  
ASAP:
ABE-0011191
CGSC:
693
ECHOBASE:
EB0389
ECOCYC:
EG10394
ECOLIHUB:
glpD
OU-MICROARRAY:
b3426
REGULONDB:
b3426
STRING:
511145.b3426
M3D: glpD
COLOMBOS: glpD
PortEco: b3426


Shine dalgarno      
Sequence: acgaaagtgaATGAGGgcagcATG


Product      
Name: aerobic glycerol 3-phosphate dehydrogenase
Synonym(s): GlpD, GlyD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 56.751
Isoelectric point: 7.497
Motif(s):
 
Type Positions Sequence
464 -> 501 DDALWRRTKQGMWLNADQQSRVSQWLVEYTQQRLSLAS
328 -> 353 QAITRDYTLDIHDENGKAPLLSVFGG
23 -> 23 A
5 -> 33 DLIVIGGGINGAGIAADAAGRGLSVLMLE
381 -> 496 TKESVLPGGAIEGDRDDYAARLRRRYPFLTESLARHYARTYGSNSELLLGNAGTVSDLGEDFGHEFYEAELKYLVDHEWVRRADDALWRRTKQGMWLNADQQSRVSQWLVEYTQQR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.6 - misc. glycerol metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005887 - integral component of plasma membrane
GO:0009331 - glycerol-3-phosphate dehydrogenase complex
molecular_function GO:0005515 - protein binding
GO:0009055 - electron transfer activity
GO:0016491 - oxidoreductase activity
GO:0004368 - glycerol-3-phosphate dehydrogenase (quinone) activity
GO:0004367 - glycerol-3-phosphate dehydrogenase [NAD+] activity
GO:0042803 - protein homodimerization activity
GO:0071949 - FAD binding
GO:0052590 - sn-glycerol-3-phosphate:ubiquinone oxidoreductase activity
GO:0052591 - sn-glycerol-3-phosphate:ubiquinone-8 oxidoreductase activity
biological_process GO:0006071 - glycerol metabolic process
GO:0009060 - aerobic respiration
GO:0009061 - anaerobic respiration
GO:0006072 - glycerol-3-phosphate metabolic process
GO:0019563 - glycerol catabolic process
GO:0046168 - glycerol-3-phosphate catabolic process
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
External database links:  
DIP:
DIP-9793N
ECOCYC:
AERGLYC3PDEHYDROG-MONOMER
ECOLIWIKI:
b3426
INTERPRO:
IPR038299
INTERPRO:
IPR000447
INTERPRO:
IPR006076
INTERPRO:
IPR031656
INTERPRO:
IPR036188
MINT:
MINT-1248675
MODBASE:
P13035
PANTHER:
PTHR11985
PDB:
2R46
PDB:
2R4E
PDB:
2QCU
PDB:
2R4J
PDB:
2R45
PFAM:
PF16901
PFAM:
PF01266
PRIDE:
P13035
PRINTS:
PR01001
PRODB:
PRO_000022795
PROSITE:
PS00977
PROSITE:
PS00978
PROTEINMODELPORTAL:
P13035
REFSEQ:
NP_417884
SMR:
P13035
UNIPROT:
P13035


Operon      
Name: glpD         
Operon arrangement:
Transcription unit        Promoter
glpD


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: ArcA, GlpR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Persson M., Glatz E., Rutberg B., 2000, Different processing of an mRNA species in Bacillus subtilis and Escherichia coli., J Bacteriol 182(3):689-95


RegulonDB