RegulonDB RegulonDB 8.7: Gene Form
   

glpD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glpD glpE yzgL GlpR GlpR GlpR GlpR CRP glpDp glpDp glpEp glpEp

Gene      
Name: glpD    Texpresso search in the literature
Synonym(s): b3426, glyD
Genome position(nucleotides): 3560036 --> 3561541 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.05
Reference(s): [1] Persson M., et al., 2000
External database links:  
ECOCYC:
EG10394
GENBANK:
2367226
GENBANK_RefSeq:
16131300
OU-MICROARRAY:
b3426
M3D: glpD
COLOMBOS: glpD
PortEco: b3426


Shine dalgarno      
Sequence: aacgaaagtgAATGAGggcagcATG


Product      
Name: GlpD
Synonym(s): GlyD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 56.751
Isoelectric point: 7.49
Motif(s):
 
Type Positions Sequence
464 -> 501 DDALWRRTKQGMWLNADQQSRVSQWLVEYTQQRLSLAS
328 -> 353 QAITRDYTLDIHDENGKAPLLSVFGG
23 -> 23 A
5 -> 33 DLIVIGGGINGAGIAADAAGRGLSVLMLE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
External database links:  
ECOCYC:
AERGLYC3PDEHYDROG-MONOMER
EXPASY:
EC-1.1.5.3
GENPROTEC:
b3426
PDB:
2R4J
PDB:
2R4E
PDB:
2R46
PDB:
2QCU
PDB:
2R45


Operon      
Name: glpD         
Operon arrangement:
Transcription unit        Promoter
glpD


Reference(s)    

 [1] Persson M., Glatz E., Rutberg B., 2000, Different processing of an mRNA species in Bacillus subtilis and Escherichia coli., J Bacteriol. 182(3):689-95


RegulonDB