RegulonDB RegulonDB 10.6.3: Gene Form
   

glpQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glpT glpQ inaA yfaH IHF GlpR GlpR GlpR SoxS Rob MarA terminator inaAp inaAp

Gene      
Name: glpQ    Texpresso search in the literature
Synonym(s): ECK2231, EG10399, b2239
Genome position(nucleotides): 2349935 <-- 2351011 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.59
External database links:  
ASAP:
ABE-0007399
CGSC:
690
ECHOBASE:
EB0394
ECOCYC:
EG10399
ECOLIHUB:
glpQ
OU-MICROARRAY:
b2239
REGULONDB:
b2239
STRING:
511145.b2239
M3D: glpQ
COLOMBOS: glpQ
PortEco: b2239


Product      
Name: glycerophosphoryl diester phosphodiesterase GlpQ
Synonym(s): GlpQ, glycerophosphoryl diester phosphodiesterase, periplasmic
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 40.843
Isoelectric point: 5.296
Motif(s):
 
Type Positions Sequence
27 -> 27 D
31 -> 355 KIVIAHRGASGYLPEHTLPAKAMAYAQGADYLEQDLVMTKDDNLVVLHDHYLDRVTDVADRFPDRARKDGRYYAIDFTLDEIKSLKFTEGFDIENGKKVQTYPGRFPMGKSDFRVHTFEEEIEFVQGLNHSTGKNIGIYPEIKAPWFHHQEGKDIAAKTLEVLKKYGYTGKDDKVYLQCFDADELKRIKNELEPKMGMELNLVQLIAYTDWNETQQKQPDGSWVNYNYDWMFKPGAMKQVAEYADGIGPDYHMLIEETSQPGNIKLTGMVQDAQQNKLVVHPYTVRSDKLPEYTPDVNQLYDALYNKAGVNGLFTDFPDKAVKFL
36 -> 350 HRGASGYLPEHTLPAKAMAYAQGADYLEQDLVMTKDDNLVVLHDHYLDRVTDVADRFPDRARKDGRYYAIDFTLDEIKSLKFTEGFDIENGKKVQTYPGRFPMGKSDFRVHTFEEEIEFVQGLNHSTGKNIGIYPEIKAPWFHHQEGKDIAAKTLEVLKKYGYTGKDDKVYLQCFDADELKRIKNELEPKMGMELNLVQLIAYTDWNETQQKQPDGSWVNYNYDWMFKPGAMKQVAEYADGIGPDYHMLIEETSQPGNIKLTGMVQDAQQNKLVVHPYTVRSDKLPEYTPDVNQLYDALYNKAGVNGLFTDFPDK
1 -> 25 MKLTLKNLSMAIMMSTIVMGSSAMA
26 -> 358 ADSNEKIVIAHRGASGYLPEHTLPAKAMAYAQGADYLEQDLVMTKDDNLVVLHDHYLDRVTDVADRFPDRARKDGRYYAIDFTLDEIKSLKFTEGFDIENGKKVQTYPGRFPMGKSDFRVHTFEEEIEFVQGLNHSTGKNIGIYPEIKAPWFHHQEGKDIAAKTLEVLKKYGYTGKDDKVYLQCFDADELKRIKNELEPKMGMELNLVQLIAYTDWNETQQKQPDGSWVNYNYDWMFKPGAMKQVAEYADGIGPDYHMLIEETSQPGNIKLTGMVQDAQQNKLVVHPYTVRSDKLPEYTPDVNQLYDALYNKAGVNGLFTDFPDKAVKFLNKE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.6 - misc. glycerol metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0042597 - periplasmic space
molecular_function GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0008081 - phosphoric diester hydrolase activity
GO:0008889 - glycerophosphodiester phosphodiesterase activity
GO:0005509 - calcium ion binding
GO:0042802 - identical protein binding
biological_process GO:0006071 - glycerol metabolic process
GO:0006629 - lipid metabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Hengge-Aronis R., et al., 1986
External database links:  
ECOCYC:
GLYCPDIESTER-PERI-MONOMER
ECOLIWIKI:
b2239
INTERPRO:
IPR030395
INTERPRO:
IPR017946
MODBASE:
P09394
PANTHER:
PTHR23344
PDB:
1YDY
PDB:
1T8Q
PFAM:
PF03009
PRIDE:
P09394
PROSITE:
PS51704
PROTEINMODELPORTAL:
P09394
REFSEQ:
NP_416742
SMR:
P09394
UNIPROT:
P09394


Operon      
Name: glpTQ         
Operon arrangement:
Transcription unit        Promoter
glpTQ


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FNR, Fis
Repressed by: IHF, GlpR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Hengge-Aronis R., Boos W., 1986, Translational control of exported proteins in Escherichia coli., J Bacteriol 167(2):462-6


RegulonDB