RegulonDB RegulonDB 10.6.3: Gene Form
   

glpR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rtcR rtcB glpG glpR IHF IHF glpRp1 glpRp1 glpRp2 glpRp2 rtcBp rtcBp rtcAp2 rtcAp2 rtcAp6 rtcAp6 rtcAp1 rtcAp1

Gene      
Name: glpR    Texpresso search in the literature
Synonym(s): ECK3409, EG10400, b3423
Type: Pseudo Gene
Genome position(nucleotides): 3559848 <-- 3560605 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.62
External database links:  
ASAP:
ABE-0011176
CGSC:
688
ECHOBASE:
EB0395
ECOCYC:
EG10400
ECOLIHUB:
glpR
OU-MICROARRAY:
b3423
REGULONDB:
b3423
STRING:
511145.b3423
UNIPROT:
P0ACL0
M3D: glpR
COLOMBOS: glpR
PortEco: b3423


Shine dalgarno      
Sequence: aaaataattcCAGGGAtttataAAT


Product      
Name: DNA-binding transcriptional repressor GlpR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: DeoR
Isoelectric point: 12.252
Motif(s):
 
Type Positions Sequence
3 -> 58 QTQRHNGIIELVKQQGYVSTEELVEHFSVSPQTIRRDLNELAEQNLILAIMAVRRC
20 -> 39 VSTEELVEHFSVSPQTIRRD
155 -> 155 R
235 -> 235 Q

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0000986 - bacterial-type proximal promoter sequence-specific DNA binding
biological_process GO:0045892 - negative regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Larson TJ., et al., 1992
[2] Larson TJ., et al., 1987
[3] Zeng G., et al., 1996
External database links:  
DIP:
DIP-9798N
ECOCYC:
PD03576
ECOLIWIKI:
b3423
INTERPRO:
IPR001034
INTERPRO:
IPR036388
INTERPRO:
IPR018356
INTERPRO:
IPR037171
INTERPRO:
IPR036390
INTERPRO:
IPR014036
MODBASE:
P0ACL0
PFAM:
PF00455
PFAM:
PF08220
PRIDE:
P0ACL0
PRINTS:
PR00037
PRODB:
PRO_000022799
PROSITE:
PS00894
PROSITE:
PS51000
PROTEINMODELPORTAL:
P0ACL0
REFSEQ:
NP_417881
SMART:
SM00420
SMR:
P0ACL0
UNIPROT:
P0ACL0


Operon      
Name: glpEGR         
Operon arrangement:
Transcription unit        Promoter
glpR
glpR
glpGR
glpEGR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rtcAp1 3556880 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter rtcAp6 3556948 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter rtcAp2 3557002 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Larson TJ., Cantwell JS., van Loo-Bhattacharya AT., 1992, Interaction at a distance between multiple operators controls the adjacent, divergently transcribed glpTQ-glpACB operons of Escherichia coli K-12., J Biol Chem 267(9):6114-21

 [2] Larson TJ., Ye SZ., Weissenborn DL., Hoffmann HJ., Schweizer H., 1987, Purification and characterization of the repressor for the sn-glycerol 3-phosphate regulon of Escherichia coli K12., J Biol Chem 262(33):15869-74

 [3] Zeng G., Ye S., Larson TJ., 1996, Repressor for the sn-glycerol 3-phosphate regulon of Escherichia coli K-12: primary structure and identification of the DNA-binding domain., J Bacteriol 178(24):7080-9

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB