RegulonDB RegulonDB 10.6.3: Gene Form
   

gltD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gltB gltD gltF TSS_3549 TSS_3549 TSS_3548 TSS_3548 TSS_3547 TSS_3547 TSS_3546 (cluster) TSS_3546 (cluster) TSS_3545 TSS_3545 TSS_3544 TSS_3544 TSS_3543 (cluster) TSS_3543 (cluster) TSS_3542 (cluster) TSS_3542 (cluster) TSS_3541 TSS_3541 TSS_3540 TSS_3540 TSS_3539 TSS_3539 TSS_3538 TSS_3538 TSS_3537 TSS_3537 TSS_3536 TSS_3536 TSS_3535 TSS_3535 TSS_3534 TSS_3534

Gene      
Name: gltD    Texpresso search in the literature
Synonym(s): ECK3203, EG10404, aspB, b3213, ossB, psiQ
Genome position(nucleotides): 3359198 --> 3360616 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.17
External database links:  
ASAP:
ABE-0010547
CGSC:
17689
ECHOBASE:
EB0399
ECOCYC:
EG10404
ECOLIHUB:
gltD
OU-MICROARRAY:
b3213
REGULONDB:
b3213
STRING:
511145.b3213
M3D: gltD
COLOMBOS: gltD
PortEco: b3213


Product      
Name: glutamate synthase subunit GltD
Synonym(s): AspB, GltD, OssB, PsiQ, glutamate synthase, small subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 52.015
Isoelectric point: 5.436
Motif(s):
 
Type Positions Sequence
38 -> 69 GQAKAQADRCLSCGNPYCEWKCPVHNYIPNWL
312 -> 313 KH
147 -> 459 KKVAIIGAGPAGLACADVLTRNGVKAVVFDRHPEIGGLLTFGIPAFKLEKEVMTRRREIFTGMGIEFKLNTEVGRDVQLDDLLSDYDAVFLGVGTYQSMRGGLENEDADGVYAALPFLIANTKQLMGFGETRDEPFVSMEGKRVVVLGGGDTAMDCVRTSVRQGAKHVTCAYRRDEENMPGSRREVKNAREEGVEFKFNVQPLGIEVNGNGKVSGVKMVRTEMGEPDAKGRRRAEIVAGSEHIVPADAVIMAFGFRPHNMEWLAKHSVELDSQGRIIAPEGSDNAFQTSNPKIFAGGDIVRGSDLVVTAIAEG
123 -> 123 E
376 -> 400 GRRRAEIVAGSEHIVPADAVIMAFG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.1 - glutamate
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.3 - nitrogen metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0004355 - glutamate synthase (NADPH) activity
GO:0016639 - oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor
GO:0004354 - glutamate dehydrogenase (NADP+) activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
biological_process GO:0006537 - glutamate biosynthetic process
GO:0006807 - nitrogen compound metabolic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0055114 - oxidation-reduction process
GO:0097054 - L-glutamate biosynthetic process
External database links:  
DIP:
DIP-9803N
ECOCYC:
GLUSYNSMALL-MONOMER
ECOLIWIKI:
b3213
INTERPRO:
IPR017896
INTERPRO:
IPR036188
INTERPRO:
IPR028261
INTERPRO:
IPR023753
INTERPRO:
IPR009051
INTERPRO:
IPR006006
MINT:
MINT-1248739
MODBASE:
P09832
PFAM:
PF14691
PFAM:
PF07992
PRIDE:
P09832
PRODB:
PRO_000022805
PROSITE:
PS51379
PROTEINMODELPORTAL:
P09832
REFSEQ:
NP_417680
SMR:
P09832
UNIPROT:
P09832


Operon      
Name: gltBDF         
Operon arrangement:
Transcription unit        Promoter
gltBDF


Transcriptional Regulation      
Display Regulation             
Activated by: HdfR, IHF, Lrp, GadE, AdiY
Repressed by: CRP, Nac, Fur, FNR, ArgR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3534 3356105 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3535 3356236 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3536 3356239 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3537 3356669 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3538 3356672 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3539 3356806 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3540 3357175 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3541 3357512 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3542 (cluster) 3357958 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3543 (cluster) 3357974 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3544 3357991 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3545 3359147 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3546 (cluster) 3359164 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3547 3359356 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3548 3359426 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3549 3359434 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB