RegulonDB RegulonDB 10.9: Gene Form
   

gor gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gor rlmJ dinQ TSS_4110 TSS_4110 gorp gorp TSS_4109 TSS_4109

Gene      
Name: gor    Texpresso search in the literature
Synonym(s): ECK3485, EG10412, b3500, gorA
Genome position(nucleotides): 3646299 --> 3647651 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.81
Note(s): In a gene expression analysis, RpoS positively regulated gor gene in the stationary phase. Its effect could be indirect Becker-Hapak M,1995.
External database links:  
ASAP:
ABE-0011432
CGSC:
665
ECHOBASE:
EB0407
ECOLIHUB:
gor
MIM:
138300
OU-MICROARRAY:
b3500
STRING:
511145.b3500
COLOMBOS: gor


Product      
Name: glutathione reductase (NADPH)
Synonym(s): Gor, GorA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 48.772
Isoelectric point: 5.881
Motif(s):
 
Type Positions Sequence
5 -> 318 YDYIAIGGGSGGIASINRAAMYGQKCALIEAKELGGTCVNVGCVPKKVMWHAAQIREAIHMYGPDYGFDTTINKFNWETLIASRTAYIDRIHTSYENVLGKNNVDVIKGFARFVDAKTLEVNGETITADHILIATGGRPSHPDIPGVEYGIDSDGFFALPALPERVAVVGAGYIAVELAGVINGLGAKTHLFVRKHAPLRSFDPMISETLVEVMNAEGPQLHTNAIPKAVVKNTDGSLTLELEDGRSETVDCLIWAIGREPANDNINLEAAGVKTNEKGYIVVDKYQNTNIEGIYAVGDNTGAVELTPVAVAAG
339 -> 449 IPTVVFSHPPIGTVGLTEPQAREQYGDDQVKVYKSSFTAMYTAVTTHRQPCRMKLVCVGSEEKIVGIHGIGFGMDEMLQGFAVALKMGATKKDFDNTVAIHPTAAEEFVTM
34 -> 41 EAKELGGT

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0050660 - flavin adenine dinucleotide binding
GO:0016668 - oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor
GO:0004362 - glutathione-disulfide reductase activity
GO:0042803 - protein homodimerization activity
GO:0050661 - NADP binding
GO:0071949 - FAD binding
biological_process GO:0006749 - glutathione metabolic process
GO:0045454 - cell redox homeostasis
GO:0055114 - oxidation-reduction process
GO:0034599 - cellular response to oxidative stress
GO:0098869 - cellular oxidant detoxification
External database links:  
ECOCYC:
GLUTATHIONE-REDUCT-NADPH-MONOMER
ECOLIWIKI:
b3500
INTERPRO:
IPR001100
INTERPRO:
IPR016156
INTERPRO:
IPR036188
INTERPRO:
IPR023753
INTERPRO:
IPR004099
INTERPRO:
IPR006322
INTERPRO:
IPR012999
MODBASE:
P06715
PANTHER:
PTHR42737
PDB:
1GET
PDB:
1GEU
PDB:
1GES
PDB:
1GER
PFAM:
PF02852
PFAM:
PF07992
PRIDE:
P06715
PRODB:
PRO_000022829
PROSITE:
PS00076
REFSEQ:
NP_417957
SMR:
P06715
UNIPROT:
P06715


Operon      
Name: gor         
Operon arrangement:
Transcription unit        Promoter
gor
gor


Transcriptional Regulation      
Display Regulation             
Activated by: OxyR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4109 3645994 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4110 3646532 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB