RegulonDB RegulonDB 11.0: Gene Form

grpE gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

yfjD nadK grpE CRP terminator anti-terminator anti-anti-terminator terminator nadKp2 nadKp2 grpEp grpEp TSS_2962 TSS_2962

Name: grpE    Texpresso search in the literature
Synonym(s): ECK2610, EG10416, b2614
Genome position(nucleotides): 2750115 <-- 2750708
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: nucleotide exchange factor GrpE
Synonym(s): GrpE, heat shock protein GrpE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.798
Isoelectric point: 4.393
Type Positions Sequence Comment
1 -> 40 MSSKEQKTPEGQAPEEIIMDQHEEIEAVEPEASAEQVDPR UniProt: Disordered; Sequence Annotation Type: region of interest.
2 -> 33 SSKEQKTPEGQAPEEIIMDQHEEIEAVEPEAS flexible N-terminal domain1
16 -> 40 EIIMDQHEEIEAVEPEASAEQVDPR UniProt: Basic and acidic residues; Sequence Annotation Type: compositionally biased region.


Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
  5 - cell processes --> 5.1 - cell division
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0019904 - protein domain specific binding
GO:0005515 - protein binding
GO:0051082 - unfolded protein binding
GO:0000774 - adenyl-nucleotide exchange factor activity
GO:0042803 - protein homodimerization activity
GO:0051087 - chaperone binding
biological_process GO:0006457 - protein folding
GO:0009408 - response to heat
GO:0065003 - protein-containing complex assembly
GO:0051085 - chaperone cofactor-dependent protein refolding
GO:0043335 - protein unfolding
External database links:  

Name: grpE         
Operon arrangement:
Transcription unit        Promoter

Transcriptional Regulation      
Display Regulation             
Activated by: CRP

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2962 2749213 forward nd [RS-EPT-CBR] [1]
  promoter nadKp2 2750763 forward nd [ICWHO] [2]


 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight


 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78
