RegulonDB RegulonDB 10.7: Gene Form
   

grxA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybjM ybjC grxA nfsA SoxS Rob MarA OxyR SoxS OxyR OxyR ybjCp ybjCp grxAp grxAp

Gene      
Name: grxA    Texpresso search in the literature
Synonym(s): ECK0840, EG10417, b0849, grx
Genome position(nucleotides): 890496 <-- 890753 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.96
External database links:  
ASAP:
ABE-0002893
CGSC:
17683
ECHOBASE:
EB0412
OU-MICROARRAY:
b0849
PORTECO:
grxA
REGULONDB:
b0849
STRING:
511145.b0849
M3D: grxA
COLOMBOS: grxA
PortEco: b0849


Product      
Name: reduced glutaredoxin 1
Synonym(s): Grx, GrxA, glutaredoxin 1
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.685
Isoelectric point: 4.571
Motif(s):
 
Type Positions Sequence
1 -> 85 MQTVIFGRSGCPYCVRAKDLAEKLSNERDDFQYQYVDIRAEGITKEDLQQKAGKPVETVPQIFVDQQHIGGYTDFAAWVKENLDA
14 -> 14 C
15 -> 15 V
10 -> 10 G
13 -> 13 Y

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.2 - thioredoxin, glutaredoxin
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0005829 - cytosol
molecular_function GO:0009055 - electron transfer activity
GO:0000166 - nucleotide binding
GO:0015035 - protein disulfide oxidoreductase activity
biological_process GO:0009263 - deoxyribonucleotide biosynthetic process
GO:0045454 - cell redox homeostasis
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
Reference(s): [1] Fernandes AP., et al., 2005
External database links:  
ECOCYC:
RED-GLUTAREDOXIN
ECOLIWIKI:
b0849
INTERPRO:
IPR014025
INTERPRO:
IPR011902
INTERPRO:
IPR011767
INTERPRO:
IPR002109
INTERPRO:
IPR036249
MODBASE:
P68688
PDB:
1UQ3
PDB:
1UQ6
PDB:
1UQ7
PDB:
1UQH
PDB:
1UQN
PDB:
1UQ2
PDB:
1UQ1
PDB:
1UQ0
PDB:
1UPZ
PDB:
1UPY
PDB:
1QFN
PDB:
1GRX
PDB:
1EGR
PDB:
1EGO
PFAM:
PF00462
PRIDE:
P68688
PRINTS:
PR00160
PROSITE:
PS00195
PROSITE:
PS51354
PROTEINMODELPORTAL:
P68688
REFSEQ:
NP_415370
SMR:
P68688
UNIPROT:
P68688


Operon      
Name: grxA         
Operon arrangement:
Transcription unit        Promoter
grxA


Transcriptional Regulation      
Display Regulation             
Activated by: OxyR
Growth Conditions:

[1] 

C: Escherichia coli| LB medium| mid exponential phase
E: Escherichia coli| LB medium| hydrogen peroxide 100 µM| mid exponential phase

[2] 

C: Escherichia coli| LB medium| hydrogen peroxide 100 µM| mid exponential phase
E: Escherichia coli| oxyR knockout mutant| LB medium| hydrogen peroxide 100 µM| mid exponential phase



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Fernandes AP., Fladvad M., Berndt C., Andresen C., Lillig CH., Neubauer P., Sunnerhagen M., Holmgren A., Vlamis-Gardikas A., 2005, A novel monothiol glutaredoxin (Grx4) from Escherichia coli can serve as a substrate for thioredoxin reductase., J Biol Chem 280(26):24544-52


RegulonDB