RegulonDB RegulonDB 10.6.3: Gene Form
   

guaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

guaA guaB yfgI DnaA TSS_2786 TSS_2786 TSS_2785 TSS_2785

Gene      
Name: guaA    Texpresso search in the literature
Synonym(s): ECK2503, EG10420, b2507
Genome position(nucleotides): 2630958 <-- 2632535 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.12
External database links:  
ASAP:
ABE-0008254
CGSC:
657
ECHOBASE:
EB0415
ECOCYC:
EG10420
ECOLIHUB:
guaA
OU-MICROARRAY:
b2507
REGULONDB:
b2507
STRING:
511145.b2507
M3D: guaA
COLOMBOS: guaA
PortEco: b2507


Product      
Name: GMP synthetase
Synonym(s): GuaA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 58.679
Isoelectric point: 5.054
Motif(s):
 
Type Positions Sequence
235 -> 241 SGGVDSS
433 -> 524 EELRKADLYDKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEVNGISRVVYDISGKPPATIEW
3 -> 3 E
208 -> 400 WTPAKIIDDAVARIREQVGDDKVILGLSGGVDSSVTAMLLHRAIGKNLTCVFVDNGLLRLNEAEQVLDMFGDHFGLNIVHVPAEDRFLSALAGENDPEAKRKIIGRVFVEVFDEEALKLEDVKWLAQGTIYPDVIESAASATGKAHVIKSHHNVGGLPKEMKMGLVEPLKELFKDEVRKIGLELGLPYDMLYR
223 -> 257 EQVGDDKVILGLSGGVDSSVTAMLLHRAIGKNLTC

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.1 - purine biosynthesis
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016462 - pyrophosphatase activity
GO:0016874 - ligase activity
GO:0003921 - GMP synthase activity
GO:0003922 - GMP synthase (glutamine-hydrolyzing) activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006164 - purine nucleotide biosynthetic process
GO:0006541 - glutamine metabolic process
GO:0006177 - GMP biosynthetic process
External database links:  
DIP:
DIP-9852N
ECOCYC:
GMP-SYN-MONOMER
ECOLIWIKI:
b2507
INTERPRO:
IPR022955
INTERPRO:
IPR029062
INTERPRO:
IPR025777
INTERPRO:
IPR022310
INTERPRO:
IPR017926
INTERPRO:
IPR014729
INTERPRO:
IPR004739
INTERPRO:
IPR001674
MODBASE:
P04079
PDB:
1GPM
PFAM:
PF00117
PFAM:
PF02540
PFAM:
PF00958
PRIDE:
P04079
PROSITE:
PS51273
PROSITE:
PS51553
PROTEINMODELPORTAL:
P04079
REFSEQ:
NP_417002
SMR:
P04079
UNIPROT:
P04079


Operon      
Name: guaBA         
Operon arrangement:
Transcription unit        Promoter
guaBA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: PurR, DnaA, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2785 2633290 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2786 2634070 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB