RegulonDB RegulonDB 10.6.3: Gene Form
   

guaB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

guaA guaB xseA yfgJ CRP MarA PurR Fis Fis Fis DnaA terminator xseAp xseAp guaBp guaBp TSS_2790 TSS_2790 TSS_2789 TSS_2789 TSS_2788 (cluster) TSS_2788 (cluster) TSS_2787 TSS_2787 TSS_2786 TSS_2786 TSS_2785 TSS_2785

Gene      
Name: guaB    Texpresso search in the literature
Synonym(s): ECK2504, EG10421, b2508, guaR
Genome position(nucleotides): 2632604 <-- 2634070 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.67
External database links:  
ASAP:
ABE-0008257
CGSC:
656
ECHOBASE:
EB0416
ECOCYC:
EG10421
ECOLIHUB:
guaB
MIM:
146691
OU-MICROARRAY:
b2508
REGULONDB:
b2508
STRING:
511145.b2508
M3D: guaB
COLOMBOS: guaB
PortEco: b2508


Product      
Name: inosine 5'-monophosphate dehydrogenase
Synonym(s): GuaB, GuaR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 52.022
Isoelectric point: 6.364
Motif(s):
 
Type Positions Sequence
8 -> 473 ALTFDDVLLVPAHSTVLPNTADLSTQLTKTIRLNIPMLSAAMDTVTEARLAIALAQEGGIGFIHKNMSIERQAEEVRRVKKHESGVVTDPQTVLPTTTLREVKELTERNGFAGYPVVTEENELVGIITGRDVRFVTDLNQPVSVYMTPKERLVTVREGEAREVVLAKMHEKRVEKALVVDDEFHLIGMITVKDFQKAERKPNACKDEQGRLRVGAAVGAGAGNEERVDALVAAGVDVLLIDSSHGHSEGVLQRIRETRAKYPDLQIIGGNVATAAGARALAEAGCSAVKVGIGPGSICTTRIVTGVGVPQITAVADAVEALEGTGIPVIADGGIRFSGDIAKAIAAGASAVMVGSMLAGTEESPGEIELYQGRSYKSYRGMGSLGAMSKGSSDRYFQSDNAADKLVPEGIEGRVAYKGRLKEIIHQQMGGLRSCMGLTGCGTIDELRTKAEFVRISGAGIQESHVH
93 -> 149 VVTDPQTVLPTTTLREVKELTERNGFAGYPVVTEENELVGIITGRDVRFVTDLNQPV
200 -> 200 D
206 -> 206 R
243 -> 243 D

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.1 - purine biosynthesis
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:1990829 - C-rich single-stranded DNA binding
GO:0003697 - single-stranded DNA binding
GO:0003824 - catalytic activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0003938 - IMP dehydrogenase activity
GO:0042802 - identical protein binding
biological_process GO:0006164 - purine nucleotide biosynthetic process
GO:0006177 - GMP biosynthetic process
GO:0009411 - response to UV
GO:0006183 - GTP biosynthetic process
GO:0055114 - oxidation-reduction process
GO:0051289 - protein homotetramerization
Reference(s): [1] Sargentini NJ., et al., 2016
External database links:  
DIP:
DIP-36207N
ECOCYC:
IMP-DEHYDROG-MONOMER
ECOLIWIKI:
b2508
INTERPRO:
IPR015875
INTERPRO:
IPR013785
INTERPRO:
IPR005990
INTERPRO:
IPR001093
INTERPRO:
IPR000644
MINT:
MINT-1235980
MODBASE:
P0ADG7
PANTHER:
PTHR11911:SF6
PFAM:
PF00478
PFAM:
PF00571
PRIDE:
P0ADG7
PRODB:
PRO_000022851
PROSITE:
PS51371
PROSITE:
PS00487
PROTEINMODELPORTAL:
P0ADG7
REFSEQ:
NP_417003
SMART:
SM00116
SMR:
P0ADG7
SWISSMODEL:
P0ADG7
UNIPROT:
P0ADG7


Operon      
Name: guaBA         
Operon arrangement:
Transcription unit        Promoter
guaBA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: PurR, DnaA, Fis


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2785 2633290 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2786 2634070 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2787 2634090 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2788 (cluster) 2634100 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2789 2634102 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2790 2634105 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Sargentini NJ., Gularte NP., Hudman DA., 2016, Screen for genes involved in radiation survival of Escherichia coli and construction of a reference database., Mutat Res 793-794:1-14

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB