RegulonDB RegulonDB 10.8: Gene Form
   

helD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

helD mgsA yccF TSS_1287 TSS_1287 TSS_1286 TSS_1286 helDp helDp yccFp yccFp yccSp2 yccSp2 yccSp3 yccSp3

Gene      
Name: helD    Texpresso search in the literature
Synonym(s): ECK0953, EG10426, b0962, srjB
Genome position(nucleotides): 1024471 --> 1026525 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.04
External database links:  
ASAP:
ABE-0003257
CGSC:
31769
ECHOBASE:
EB0421
OU-MICROARRAY:
b0962
PortEco:
helD
STRING:
511145.b0962
COLOMBOS: helD


Product      
Name: DNA helicase IV
Synonym(s): HelD, SrjB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 77.976
Isoelectric point: 8.463
Motif(s):
 
Type Positions Sequence
1 -> 164 MELKATTLGKRLAQHPYDRAVILNAGIKVSGDRHEYLIPFNQLLAIHCKRGLVWGELEFVLPDEKVVRLHGTEWGETQRFYHHLDAHWRRWSGEMSEIASGVLRQQLDLIATRTGENKWLTREQTSGVQQQIRQALSALPLPVNRLEEFDNCREAWRKCQAWLK
365 -> 366 MH
70 -> 70 H
197 -> 490 LNPAQARAVVNGEHSLLVLAGAGSGKTSVLVARAGWLLARGEASPEQILLLAFGRKAAEEMDERIRERLHTEDITARTFHALALHIIQQGSKKVPIVSKLENDTAARHELFIAEWRKQCSEKKAQAKGWRQWLTEEMQWSVPEGNFWDDEKLQRRLASRLDRWVSLMRMHGGAQAEMIASAPEEIRDLFSKRIKLMAPLLKAWKGALKAENAVDFSGLIHQAIVILEKGRFISPWKHILVDEFQDISPQRAALLAALRKQNSQTTLFAVGDDWQAIYRFSGAQMSLTTAFHENF
137 -> 140 SALP

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.3 - DNA recombination
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0033202 - DNA helicase complex
molecular_function GO:0003677 - DNA binding
GO:0003678 - DNA helicase activity
GO:0004386 - helicase activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0043138 - 3'-5' DNA helicase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0006281 - DNA repair
GO:0006310 - DNA recombination
GO:0032508 - DNA duplex unwinding
GO:0000725 - recombinational repair
Note(s): Note(s): ...[more].
Evidence: [APP] Assay of partially-purified protein
[IMP] Inferred from mutant phenotype
Reference(s): [1] Mendonca VM., et al., 1995
[2] Mendonca VM., et al., 1995
[3] Wood ER., et al., 1987
External database links:  
DIP:
DIP-9876N
ECOCYC:
EG10426-MONOMER
ECOLIWIKI:
b0962
INTERPRO:
IPR014016
INTERPRO:
IPR034739
INTERPRO:
IPR027417
INTERPRO:
IPR022161
INTERPRO:
IPR014017
INTERPRO:
IPR000212
MINT:
MINT-1226516
MODBASE:
P15038
PANTHER:
PTHR11070
PFAM:
PF00580
PFAM:
PF12462
PFAM:
PF13361
PRIDE:
P15038
PRODB:
PRO_000022873
PROSITE:
PS51198
REFSEQ:
NP_415482
SMART:
SM00388
SMR:
P15038
UNIPROT:
P15038


Operon      
Name: helD         
Operon arrangement:
Transcription unit        Promoter
helD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yccSp3 1023976 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter yccSp2 1023994 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_1286 1024442 forward nd [RS-EPT-CBR] [5]
  promoter TSS_1287 1025511 forward nd [RS-EPT-CBR] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Mendonca VM., Klepin HD., Matson SW., 1995, DNA helicases in recombination and repair: construction of a delta uvrD delta helD delta recQ mutant deficient in recombination and repair., J Bacteriol 177(5):1326-35

 [2] Mendonca VM., Matson SW., 1995, Genetic analysis of delta helD and delta uvrD mutations in combination with other genes in the RecF recombination pathway in Escherichia coli: suppression of a ruvB mutation by a uvrD deletion., Genetics 141(2):443-52

 [3] Wood ER., Matson SW., 1987, Purification and characterization of a new DNA-dependent ATPase with helicase activity from Escherichia coli., J Biol Chem 262(31):15269-76

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB