RegulonDB RegulonDB 10.9: Gene Form
   

hflK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hflX hflK hflC anti-anti-terminator TSS_5026 TSS_5026 TSS_5025 TSS_5025 TSS_5024 TSS_5024 TSS_5023 TSS_5023 TSS_5022 TSS_5022 TSS_5021 TSS_5021 TSS_5020 TSS_5020 TSS_5019 TSS_5019 TSS_5018 TSS_5018 TSS_5017 (cluster) TSS_5017 (cluster)

Gene      
Name: hflK    Texpresso search in the literature
Synonym(s): ECK4170, EG10436, b4174, hflA, hslY
Genome position(nucleotides): 4402038 --> 4403297 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.19
External database links:  
ASAP:
ABE-0013663
CGSC:
639
ECHOBASE:
EB0431
ECOLIHUB:
hflK
OU-MICROARRAY:
b4174
STRING:
511145.b4174
COLOMBOS: hflK


Product      
Name: regulator of FtsH protease
Synonym(s): HflA, HflK, HslY
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,periplasmic space,inner membrane
Molecular weight: 45.545
Isoelectric point: 6.211
Motif(s):
 
Type Positions Sequence
99 -> 270 TIKEAERGVVTRFGKFSHLVEPGLNWKPTFIDEVKPVNVEAVRELAASGVMLTSDENVVRVEMNVQYRVTNPEKYLYSVTSPDDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEETIRPYDMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEA
145 -> 145 A
80 -> 100 VVTIAAAAIVIIWAASGFYTI
1 -> 59 MAWNQPGNNGQDRDPWGSSKPGGNSEGNGNKGGRDQGPPDLDDIFRKLSKKLGGLGGGK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.4 - proteases, cleavage of compounds
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0071575 - integral component of external side of plasma membrane
GO:0098796 - membrane protein complex
molecular_function GO:0005515 - protein binding
biological_process GO:0009408 - response to heat
GO:0043086 - negative regulation of catalytic activity
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
[IGI] Inferred from genetic interaction
Reference(s): [1] Kihara A., et al., 1996
[2] Kihara A., et al., 1997
External database links:  
DIP:
DIP-47481N
ECOCYC:
EG10436-MONOMER
ECOLIWIKI:
b4174
INTERPRO:
IPR036013
INTERPRO:
IPR020980
INTERPRO:
IPR001107
INTERPRO:
IPR001972
INTERPRO:
IPR010201
MINT:
P0ABC7
PANTHER:
PTHR43327:SF2
PFAM:
PF12221
PFAM:
PF01145
PRIDE:
P0ABC7
PRINTS:
PR00721
PRODB:
PRO_000022884
REFSEQ:
NP_418595
SMART:
SM00244
SMR:
P0ABC7
UNIPROT:
P0ABC7


Operon      
Name: nnr-tsaE-amiB-mutL-miaA-hfq-hflXKC         
Operon arrangement:
Transcription unit        Promoter
yjeFE-amiB-mutL-miaA-hfq-hflXKC
yjeFE-amiB-mutL-miaA-hfq-hflXKC
yjeFE-amiB-mutL-miaA-hfq-hflXKC
mutL-miaA-hfq-hflXKC
mutL-miaA-hfq-hflXKC
miaA-hfq-hflXKC
miaA-hfq-hflXKC
hfq-hflXKC
hfq-hflXKC
hfq-hflXKC
tsaE-amiB-mutL-miaA-hfq-hflXKC


Transcriptional Regulation      
Display Regulation             
Repressed by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5017 (cluster) 4401549 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_5018 4401552 forward nd [RS-EPT-CBR] [3]
  promoter TSS_5019 4401621 forward nd [RS-EPT-CBR] [3]
  promoter TSS_5020 4401731 forward nd [RS-EPT-CBR] [3]
  promoter TSS_5021 4401841 forward nd [RS-EPT-CBR] [3]
  promoter TSS_5022 4401847 forward nd [RS-EPT-CBR] [3]
  promoter TSS_5023 4401919 forward nd [RS-EPT-CBR] [3]
  promoter TSS_5024 4402016 forward nd [RS-EPT-CBR] [3]
  promoter TSS_5025 4402405 forward nd [RS-EPT-CBR] [3]
  promoter TSS_5026 4403431 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Kihara A., Akiyama Y., Ito K., 1996, A protease complex in the Escherichia coli plasma membrane: HflKC (HflA) forms a complex with FtsH (HflB), regulating its proteolytic activity against SecY., EMBO J 15(22):6122-31

 [2] Kihara A., Akiyama Y., Ito K., 1997, Host regulation of lysogenic decision in bacteriophage lambda: transmembrane modulation of FtsH (HflB), the cII degrading protease, by HflKC (HflA)., Proc Natl Acad Sci U S A 94(11):5544-9

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB