RegulonDB RegulonDB 10.9: Gene Form
   

hflX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hflX hflK hfq TSS_5025 TSS_5025 TSS_5024 TSS_5024 TSS_5023 TSS_5023 TSS_5022 TSS_5022 TSS_5021 TSS_5021 TSS_5020 TSS_5020 TSS_5019 TSS_5019 TSS_5018 TSS_5018 TSS_5017 (cluster) TSS_5017 (cluster)

Gene      
Name: hflX    Texpresso search in the literature
Synonym(s): ECK4169, EG10437, b4173, hflA, hslX
Genome position(nucleotides): 4400672 --> 4401952 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.86
External database links:  
ASAP:
ABE-0013661
CGSC:
34423
ECHOBASE:
EB0432
ECOLIHUB:
hflX
OU-MICROARRAY:
b4173
STRING:
511145.b4173
COLOMBOS: hflX


Product      
Name: ribosome rescue factor HflX
Synonym(s): HflA, HflX, HslX, ribosome-dissociating factor, GTPase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 48.327
Isoelectric point: 5.842
Motif(s):
 
Type Positions Sequence
56 -> 56 Y
114 -> 192 RARTHEGKLQVELAQLRHLATRLVRGWTHLERQKGGIGLRGPGETQLETDRRLLRNRIVQIQSRLERVEKQREQGRQSR
198 -> 365 PTVSLVGYTNAGKSTLFNRITEARVYAADQLFATLDPTLRRIDVADVGETVLADTVGFIRHLPHDLVAAFKATLQETRQATLLLHVIDAADVRVQENIEAVNTVLEEIDAHEIPTLLVMNKIDMLEDFEPRIDRDEENKPNRVWLSAQTGAGIPQLFQALTERLSGEV
343 -> 345 SAQ
53 -> 53 H

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.6 - ribosomes
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016887 - ATPase activity
GO:0043022 - ribosome binding
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0003924 - GTPase activity
GO:0005524 - ATP binding
GO:0019843 - rRNA binding
GO:0005525 - GTP binding
GO:0043023 - ribosomal large subunit binding
GO:0097216 - guanosine tetraphosphate binding
biological_process GO:0009408 - response to heat
GO:0032790 - ribosome disassembly
GO:0072344 - rescue of stalled ribosome
GO:0036289 - peptidyl-serine autophosphorylation
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
Reference(s): [1] Ash MR., et al., 2012
[2] Cheng HH., et al., 1987
[3] Mandava CS., et al., 2015
[4] Tsui HC., et al., 1994
External database links:  
DIP:
DIP-9895N
ECOCYC:
EG10437-MONOMER
ECOLIWIKI:
b4173
INTERPRO:
IPR032305
INTERPRO:
IPR042108
INTERPRO:
IPR035647
INTERPRO:
IPR030394
INTERPRO:
IPR027417
INTERPRO:
IPR025121
INTERPRO:
IPR016496
INTERPRO:
IPR006073
MODBASE:
P25519
PANTHER:
PTHR10229
PDB:
5ZZM
PDB:
5ADY
PFAM:
PF16360
PFAM:
PF13167
PFAM:
PF01926
PRIDE:
P25519
PRINTS:
PR00326
PRODB:
PRO_000022885
PROSITE:
PS51705
REFSEQ:
NP_418594
SMR:
P25519
UNIPROT:
P25519


Operon      
Name: nnr-tsaE-amiB-mutL-miaA-hfq-hflXKC         
Operon arrangement:
Transcription unit        Promoter
yjeFE-amiB-mutL-miaA-hfq-hflXKC
yjeFE-amiB-mutL-miaA-hfq-hflXKC
yjeFE-amiB-mutL-miaA-hfq-hflXKC
mutL-miaA-hfq-hflXKC
mutL-miaA-hfq-hflXKC
miaA-hfq-hflXKC
miaA-hfq-hflXKC
hfq-hflXKC
hfq-hflXKC
hfq-hflXKC
tsaE-amiB-mutL-miaA-hfq-hflXKC


Transcriptional Regulation      
Display Regulation             
Repressed by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5017 (cluster) 4401549 forward For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_5018 4401552 forward nd [RS-EPT-CBR] [5]
  promoter TSS_5019 4401621 forward nd [RS-EPT-CBR] [5]
  promoter TSS_5020 4401731 forward nd [RS-EPT-CBR] [5]
  promoter TSS_5021 4401841 forward nd [RS-EPT-CBR] [5]
  promoter TSS_5022 4401847 forward nd [RS-EPT-CBR] [5]
  promoter TSS_5023 4401919 forward nd [RS-EPT-CBR] [5]
  promoter TSS_5024 4402016 forward nd [RS-EPT-CBR] [5]
  promoter TSS_5025 4402405 forward nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Ash MR., Maher MJ., Mitchell Guss J., Jormakka M., 2012, The cation-dependent G-proteins: In a class of their own., FEBS Lett 586(16):2218-24

 [2] Cheng HH., Echols H., 1987, A class of Escherichia coli proteins controlled by the hflA locus., J Mol Biol 196(3):737-40

 [3] Mandava CS., Cao W., Li X., Zhang D., Li N., Zhang Y., Zhang X., Qin Y., Mi K., Lei J., Sanyal S., Gao N., 2015, HflX is a ribosome-splitting factor rescuing stalled ribosomes under stress conditions., Nat Struct Mol Biol 22(11):906-13

 [4] Tsui HC., Leung HC., Winkler ME., 1994, Characterization of broadly pleiotropic phenotypes caused by an hfq insertion mutation in Escherichia coli K-12., Mol Microbiol 13(1):35-49

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB