RegulonDB RegulonDB 10.7: Gene Form
   

hha gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

maa tomB hha hhap6 hhap6 TSS_615 (cluster) TSS_615 (cluster) TSS_614 TSS_614 TSS_613 TSS_613

Gene      
Name: hha    Texpresso search in the literature
Synonym(s): ECK0454, EG10439, b0460
Genome position(nucleotides): 480090 <-- 480308 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
40.64
External database links:  
ASAP:
ABE-0001594
CGSC:
31084
ECHOBASE:
EB0434
OU-MICROARRAY:
b0460
PORTECO:
hha
REGULONDB:
b0460
STRING:
511145.b0460
M3D: hha
COLOMBOS: hha
PortEco: b0460


Product      
Name: haemolysin expression-modulating protein Hha
Synonym(s): Hha
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 8.628
Isoelectric point: 9.063
Motif(s):
 
Type Positions Sequence
13 -> 69 MRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWK
10 -> 10 D
22 -> 22 D
37 -> 37 D
48 -> 48 D

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.4 - global
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
biological_process GO:0010468 - regulation of gene expression
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Blanco A., et al., 1991
[2] Castellarnau M., et al., 2006
[3] Cordeiro TN., et al., 2008
[4] Garcia J., et al., 2006
[5] Garcia-Contreras R., et al., 2008
[6] Juarez A., et al., 2000
[7] Kim MS., et al., 2005
[8] Madrid C., et al., 2007
[9] Nieto JM., et al., 1991
[10] Nieto JM., et al., 1996
[11] Nieto JM., et al., 1997
[12] Pons JI., et al., 2004
[13] de la Cruz F., et al., 1992
External database links:  
DIP:
DIP-9897N
ECOCYC:
EG10439-MONOMER
ECOLIWIKI:
b0460
INTERPRO:
IPR036666
INTERPRO:
IPR007985
MINT:
P0ACE3
MODBASE:
P0ACE3
PDB:
2MW2
PDB:
1JW2
PFAM:
PF05321
PRIDE:
P0ACE3
PRODB:
PRO_000022887
PROTEINMODELPORTAL:
P0ACE3
REFSEQ:
NP_414993
SMR:
P0ACE3
UNIPROT:
P0ACE3


Operon      
Name: tomB-hha         
Operon arrangement:
Transcription unit        Promoter
 


Transcriptional Regulation      
Display Regulation             
Activated by: CpxR, BasR
Repressed by: PdhR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_613 480423 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_614 480431 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_615 (cluster) 480436 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [14]
  promoter hhap6 480503 reverse Similarity to the consensus
Read more >
[ICWHO] [15]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Blanco A., Juarez A., Pastor FI., 1991, Overproduction of a Clostridium cellulolyticum endoglucanase by mutant strains of Escherichia coli., FEMS Microbiol Lett 65(2):221-6

 [2] Castellarnau M., Errachid A., Madrid C., Juarez A., Samitier J., 2006, Dielectrophoresis as a tool to characterize and differentiate isogenic mutants of Escherichia coli., Biophys J 91(10):3937-45

 [3] Cordeiro TN., Garcia J., Pons JI., Aznar S., Juarez A., Pons M., 2008, A single residue mutation in Hha preserving structure and binding to H-NS results in loss of H-NS mediated gene repression properties., FEBS Lett 582(20):3139-44

 [4] Garcia J., Madrid C., Juarez A., Pons M., 2006, New roles for key residues in helices H1 and H2 of the Escherichia coli H-NS N-terminal domain: H-NS dimer stabilization and Hha binding., J Mol Biol 359(3):679-89

 [5] Garcia-Contreras R., Zhang XS., Kim Y., Wood TK., 2008, Protein translation and cell death: the role of rare tRNAs in biofilm formation and in activating dormant phage killer genes., PLoS ONE 3(6):e2394

 [6] Juarez A., Nieto JM., Prenafeta A., Miquelay E., Balsalobre C., Carrascal M., Madrid C., 2000, Interaction of the nucleoid-associated proteins Hha and H-NS to modulate expression of the hemolysin operon in Escherichia coli., Adv Exp Med Biol 485:127-31

 [7] Kim MS., Bae SH., Yun SH., Lee HJ., Ji SC., Lee JH., Srivastava P., Lee SH., Chae H., Lee Y., Choi BS., Chattoraj DK., Lim HM., 2005, Cnu, a novel oriC-binding protein of Escherichia coli., J Bacteriol 187(20):6998-7008

 [8] Madrid C., Garcia J., Pons M., Juarez A., 2007, Molecular evolution of the H-NS protein: interaction with Hha-like proteins is restricted to enterobacteriaceae., J Bacteriol 189(1):265-8

 [9] Nieto JM., Carmona M., Bolland S., Jubete Y., de la Cruz F., Juarez A., 1991, The hha gene modulates haemolysin expression in Escherichia coli., Mol Microbiol 5(5):1285-93

 [10] Nieto JM., Juarez A., 1996, A new member of the Hha/YmoA class of bacterial regulators in plasmid R100 of Escherichia coli?, Mol Microbiol 19(2):407

 [11] Nieto JM., Mourino M., Balsalobre C., Madrid C., Prenafeta A., Munoa FJ., Juarez A., 1997, Construction of a double hha hns mutant of Escherichia coli: effect on DNA supercoiling and alpha-haemolysin production., FEMS Microbiol Lett 155(1):39-44

 [12] Pons JI., Rodriguez S., Madrid C., Juarez A., Nieto JM., 2004, In vivo increase of solubility of overexpressed Hha protein by tandem expression with interacting protein H-NS., Protein Expr Purif 35(2):293-7

 [13] de la Cruz F., Carmona M., Juarez A., 1992, The Hha protein from Escherichia coli is highly homologous to the YmoA protein from Yersinia enterocolitica., Mol Microbiol 6(22):3451-2

 [14] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [15] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB